Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CtBP2 antibody
The CtBP2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets CtBP2, a protein involved in various cellular processes such as epidermal growth factor signaling and regulation of β-catenin. This antibody is designed to recognize and bind to CtBP2 with high affinity, making it an essential tool for studying the function and localization of this protein.Eotaxin 3 antibody (biotin)
<p>Eotaxin 3 antibody (biotin) was raised in goat using highly pure recombinant human eotaxin-3 as the immunogen.</p>TFEB antibody
<p>The TFEB antibody is a versatile and powerful tool in the field of Life Sciences. It is an antiviral and natriuretic antibody that specifically targets brain natriuretic peptide (BNP). This antibody can be used for various applications, including electrophoresis, where it can detect BNP in human serum samples. Additionally, the TFEB antibody has been shown to have chemokine activity, making it an excellent choice for studying immune responses.</p>Carbonyl Reductase 1 antibody
<p>Carbonyl Reductase 1 antibody was raised using the C terminal of CBR1 corresponding to a region with amino acids PGWVRTDMAGPKATKSPEEGAETPVYLALLPPDAEGPHGQFVSEKRVEQW</p>Integrin beta antibody
<p>Integrin beta antibody is a powerful tool used in Life Sciences research. It is a monoclonal antibody that specifically binds to integrin beta, a receptor involved in cell adhesion and signaling. This antibody can be used to study various cellular processes, including cell migration, proliferation, and differentiation. Integrin beta antibody has been widely used in studies related to cancer research, autoimmune diseases, and inflammation. Its high specificity and affinity make it an ideal choice for researchers looking to investigate the role of integrin beta in different biological systems. Whether you are studying growth factors, chemokines, or collagen interactions, this antibody will provide valuable insights into cellular mechanisms. With its precise targeting ability and disulfide bond formation inhibition properties, Integrin beta antibody is a crucial component in understanding complex molecular pathways. Trust this reliable tool for your research needs and unlock new discoveries in the field of Life Sciences.</p>TNFSF10 antibody
<p>TNFSF10 antibody was raised in rabbit using the N terminal of TNFSF10 as the immunogen</p>BRCA2 antibody
<p>The BRCA2 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It specifically targets the BRCA2 protein, which is involved in DNA repair and maintenance of genomic stability. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and flow cytometry. It has been shown to have high affinity and specificity for the BRCA2 protein, making it a valuable tool for studying its function and regulation. Additionally, this antibody does not cross-react with other proteins such as transferrin, alpha-fetoprotein, collagen, or lipoprotein lipase, ensuring accurate and reliable results. Whether you are studying DNA repair mechanisms or investigating the role of BRCA2 in cancer development, this BRCA2 antibody will provide you with the precise and reliable data you need for your research.</p>Mammaglobin 1 antibody
Mammaglobin 1 antibody was raised in Mouse using a purified recombinant fragment of SCGB2A2(aa1-193) expressed in E. coli as the immunogen.CDC2 antibody
The CDC2 antibody is a highly specialized antibody used in Life Sciences research. It is specifically designed to target and bind to the CDC2 protein, which plays a crucial role in cell division and regulation. This antibody is widely used in studies involving mesenchymal stem cells and their activation, as well as in the detection of autoantibodies and amyloid plaque formation.VPS26A antibody
<p>VPS26A antibody was raised in rabbit using the C terminal of VPS26A as the immunogen</p>PGM2 antibody
<p>The PGM2 antibody is a highly specialized antibody used in Life Sciences for various applications. It is a polyclonal antibody that specifically targets PGM2, a glycoprotein involved in transfer reactions. This antibody is commonly used in immunoassays and other research techniques to detect and quantify PGM2 levels in biological samples.</p>CD166 antibody
<p>CD166 antibody was raised in Mouse using a purified recombinant fragment of CD166(aa405-524) expressed in E. coli as the immunogen.</p>RIPK1 antibody
<p>RIPK1 antibody was raised in rabbit using the middle region of RIPK1 as the immunogen</p>KCTD13 antibody
<p>KCTD13 antibody was raised using the N terminal of KCTD13 corresponding to a region with amino acids PGPAAYGLKPLTPNSKYVKLNVGGSLHYTTLRTLTGQDTMLKAMFSGRVE</p>IPP antibody
IPP antibody was raised using the C terminal of IPP corresponding to a region with amino acids EMQGLIYVIGGISNEGIELRSFEVYDPLSKRWSPLPPMGTRRAYLGVAALTroponin T Type 3 antibody
<p>Troponin T Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRPKLTAPKIPEGEKVDFDDIQKKRQNKDLMELQALIDSHFEARKKEEEE</p>WDR49 antibody
WDR49 antibody was raised using the N terminal of WDR49 corresponding to a region with amino acids SQDFRCLFHFDEAHGRLFISFNNQLALLAMKSEASKRVKSHEKAVTCVLYFAK antibody
<p>FAK antibody was raised in Mouse using a purified recombinant fragment of human FAK expressed in E. coli as the immunogen.</p>SGSH antibody
<p>The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.</p>AP2M1 antibody
The AP2M1 antibody is a highly specialized antibody used in Life Sciences research. It is primarily used to detect androgen receptors in blood plasma, making it an invaluable tool for studying hormone-related processes. This cytotoxic antibody specifically targets actin filaments within cells, allowing researchers to visualize and study the dynamics of actin in various cellular processes. Additionally, the AP2M1 antibody can be used to investigate the role of nuclear antigens and extracellular proteins involved in cell signaling pathways. Its high specificity and sensitivity make it a valuable tool for researchers studying microvessel density and other related areas of research. Whether you need a monoclonal or polyclonal antibody, the AP2M1 antibody is an excellent choice for your research needs.CSB antibody
<p>CSB antibody is a high-quality polyclonal antibody that targets specific proteins and antigens in various life science applications. This antibody is widely used in research and diagnostics due to its exceptional sensitivity and specificity. It has been extensively validated for its ability to detect and neutralize a wide range of target proteins, including neurotrophic factors, glucagon, endothelial growth factors, and more. The CSB antibody utilizes advanced phosphatase technology and colloidal electrodes to ensure accurate and reliable results. Whether you are studying protein expression, conducting immunoassays, or investigating cellular pathways, the CSB antibody is an indispensable tool for your research needs. Trust in its superior performance to accelerate your scientific discoveries.</p>VWF antibody (biotin)
VWF antibody (biotin) was raised in goat using human vWF purified from plasma as the immunogen.
