Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,392 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Peptide YY antibody
<p>The Peptide YY antibody is a monoclonal antibody that specifically targets and neutralizes Peptide YY in human serum. It has been shown to interfere with the binding of Peptide YY to its receptor, thereby inhibiting its biological activity. This antibody can be used in various applications, including immunoassays, immunohistochemistry, and western blotting. The Peptide YY antibody recognizes a specific epitope on Peptide YY, making it highly specific and reliable for research purposes. It has been extensively tested and validated in Life Sciences studies, demonstrating its effectiveness in detecting and quantifying Peptide YY levels. Additionally, this antibody exhibits low cross-reactivity with other related molecules, ensuring accurate and precise results. Whether you are studying the role of Peptide YY in metabolism regulation or investigating its potential as a therapeutic target, the Peptide YY antibody is an invaluable tool for your research needs.</p>MCL1 antibody
<p>The MCL1 antibody is a highly specialized monoclonal antibody that targets the growth factor MCL1. It plays a crucial role in regulating cell survival and apoptosis. This antibody specifically binds to MCL1, inhibiting its activity and promoting cell death in cancer cells.</p>CIRBP antibody
<p>CIRBP antibody was raised using the N terminal of CIRBP corresponding to a region with amino acids MASDEGKLFVGGLSFDTNEQSLEQVFSKYGQISEVVVVKDRETQRSRGFG</p>ApoA-I antibody
<p>ApoA-I antibody was raised in Mouse using a purified recombinant fragment of human APOA1 expressed in E. coli as the immunogen.</p>KBTBD8 antibody
<p>KBTBD8 antibody was raised in rabbit using the N terminal of KBTBD8 as the immunogen</p>CD54 antibody
<p>The CD54 antibody is a highly specific antigen-binding protein that belongs to the group of polyclonal and monoclonal antibodies. It is widely used in life sciences research for its ability to target and bind to CD54, also known as intercellular adhesion molecule-1 (ICAM-1). This glycoprotein plays a crucial role in cell-to-cell interactions and immune response modulation.</p>JNK1/2/3 antibody (Thr183+Tyr185)
<p>Purified Rabbit polyclonal JNK1/2/3 antibody (Thr183+Tyr185)</p>SATB1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that belongs to the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that have bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high frequency of human activity using a patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically binds to markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>TGF beta 1 antibody
<p>The TGF beta 1 antibody is a monoclonal antibody that specifically targets the growth factor TGF-beta 1. This antibody is reactive and can be used in various applications within the Life Sciences field. It has been shown to be effective in neutralizing the activity of TGF-beta 1, which plays a crucial role in cell proliferation, differentiation, and immune response regulation. The TGF beta 1 antibody is polymorphic, meaning it can recognize different forms of the target protein due to its specificity for specific epitopes. It has been successfully used in experiments involving imatinib-treated human serum samples, where it demonstrated its ability to detect activated TGF-beta 1. This antibody can be utilized in techniques such as immunoblotting and electrophoresis to study the expression and function of TGF-beta 1 in various biological systems.</p>cMyc antibody
<p>The cMyc antibody is a highly specialized molecule drug used in Life Sciences research. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and apoptosis. This antibody specifically targets the cMyc protein, which is involved in regulating gene expression.</p>BCAT1 antibody
<p>The BCAT1 antibody is a test compound that specifically targets and binds to the BCAT1 protein. This monoclonal antibody has been developed for use in various research applications in the field of Life Sciences. The BCAT1 protein is involved in several important cellular processes, including amino acid metabolism and energy production. By targeting BCAT1, this antibody can help researchers gain a better understanding of its function and potential therapeutic applications.</p>MTHFD1 antibody
<p>MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPG</p>pan Keratin antibody
<p>pan Keratin antibody was raised in mouse using Cells of lung cancer cell line A549 and A2182 as the immunogen.</p>RBM47 antibody
<p>RBM47 antibody was raised using the middle region of RBM47 corresponding to a region with amino acids HFTSREDAVHAMNNLNGTELEGSCLEVTLAKPVDKEQYSRYQKAARGGGA</p>HPRT antibody
<p>HPRT antibody was raised in Mouse using a purified recombinant fragment of HPRT expressed in E. coli as the immunogen.</p>SPAM1 antibody
<p>The SPAM1 antibody is a highly specialized cell cytotoxicity agent that has been extensively studied in the field of Life Sciences. It is derived from a proteolytic enzyme found in gingivalis culture and has shown remarkable efficacy in various applications. The SPAM1 antibody is commonly used as a selectable marker in DNA vaccines and has been proven to effectively target specific proteins, such as LC3 protein, in cellular processes.</p>Dengue NS1 antibody
<p>The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.</p>MHC Class I antibody (allophycocyanin)
<p>Mouse monoclonal MHC Class I antibody (allophycocyanin)</p>
