Primary Antibodies

<p>Rabbit polyclonal HMMR antibody</p>

Mouse monoclonal BEST3 antibody

The PDLIM2 antibody is a highly specific monoclonal antibody that is used in various life science assays. It is designed to detect and bind to the PDLIM2 protein, which plays a crucial role in regulating cell proliferation, differentiation, and apoptosis. This antibody has been extensively validated for its high affinity and specificity, making it an ideal tool for researchers studying the function of PDLIM2 in different biological systems.

<p>HSPA1A antibody was raised in Rabbit using Human HSPA1A as the immunogen</p>

Rabbit polyclonal UGT8 antibody

<p>The LGALS3BP antibody is a monoclonal antibody that has been developed for use in various applications within the field of Life Sciences. It specifically targets LGALS3BP, a protein involved in multiple cellular processes including cell signaling, immune response, and cancer progression.</p>

<p>Mouse monoclonal PACSIN3 antibody</p>

<p>Rat pan T cell antibody (biotin) was raised in mouse using rat lymphocytes as the immunogen.</p>

<p>HRASLS5 antibody was raised in Rabbit using Human HRASLS5 as the immunogen</p>

<p>Mouse monoclonal CD5 antibody (biotin)</p>

<p>The NANP antibody is a monoclonal antibody that specifically targets the circumsporozoite protein. It is colloidal in nature and has been extensively used in various research applications in the Life Sciences field. This antibody has shown promising results in the study of exocytosis and its role in cellular processes. Additionally, it has demonstrated binding affinity towards growth factors such as epidermal growth factor and collagen. The NANP antibody is derived from hybridoma cells and exhibits high specificity and sensitivity when used for immunodetection assays. Its application extends to protein kinase studies, terminal deoxynucleotidyl transferase assays, and analysis of human serum samples.</p>

<p>MEA1 antibody was raised in Rabbit using Human MEA1 as the immunogen</p>

<p>Properdin antibody was raised in Mouse using Human properdin purified from blood as the immunogen.</p>

Mouse monoclonal NDUFA7 antibody

<p>Purified Rabbit polyclonal FOXO1A antibody (Ser322+Ser325)</p>

<p>HSP90AB1 antibody was raised in Rabbit using Human HSP90AB1 as the immunogen</p>

<p>Purified Polyclonal Kv7.1 antibody</p>

Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.

The FDFT1 antibody is a highly specialized monoclonal antibody that targets the growth factor protein kinase. It specifically binds to tyrosine residues on particulate proteins, preventing their activation and interfering with cellular signaling pathways. This antibody has been shown to have potent neutralizing activity against necrosis factor-related apoptosis-inducing ligand (TRAIL), a protein involved in programmed cell death. In addition, the FDFT1 antibody has demonstrated efficacy in inhibiting the replication of influenza virus by targeting the glycosylation process required for viral entry into host cells. This antibody holds great potential in the field of life sciences and may have applications in therapeutic interventions for various diseases and conditions.

<p>Rabbit polyclonal SPIRE2 antibody</p>

<p>BCAT2 antibody was raised in Rabbit using Human BCAT2 as the immunogen</p>

<p>EMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SLETVKVGKTYELLNCDKHKSILLKNGRDPGEARPDITHQSLLMLMDSPL</p>

The EEF2 antibody is a monoclonal antibody that specifically targets vascular endothelial growth factor (VEGF). It has been shown to effectively inhibit the activity of VEGF, a protein involved in angiogenesis and tumor growth. The EEF2 antibody has been extensively studied in various research fields, including Life Sciences and oncology. It has demonstrated its efficacy in inhibiting the proliferation of cancer cells, particularly in breast cancer cell lines such as MCF-7. Additionally, this antibody has been used to study the activation of fibrinogen and protein kinase pathways in different cellular contexts. Its high specificity and affinity make it a valuable tool for researchers studying VEGF-related processes and developing targeted therapies.

The SOCS3 antibody is a monoclonal antibody that specifically targets and binds to the protein suppressor of cytokine signaling 3 (SOCS3). It has been extensively studied in the field of Life Sciences and has shown promising results in various applications.

<p>BOLA1 antibody was raised in Rabbit using Human BOLA1 as the immunogen</p>

Rat monoclonal Galectin3 / Mac2 antibody (biotin)

The Notch 1 antibody is a highly reactive protein that belongs to the class of antibodies. It is specifically designed to target and bind to the glial fibrillary acidic protein (GFAP), which is commonly found in human serum. This monoclonal antibody has been extensively tested and validated using various techniques, including particle chemiluminescence and immunoassays.

Mouse monoclonal TulP3 antibody

<p>The RUNX1 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. This monoclonal antibody specifically targets the histidine-rich region of the RUNX1 protein, which is essential for its function. It has been extensively studied and proven to be effective in detecting and quantifying RUNX1 autoantibodies in biological samples.</p>

<p>Rabbit polyclonal UNG antibody</p>

The Human Growth Hormone antibody is a cytotoxic protein that belongs to the category of antibodies in Life Sciences. It specifically targets and neutralizes the activity of human growth hormone. This monoclonal antibody has been extensively studied and shown to have a high affinity for its target, making it an effective tool for research purposes. The Human Growth Hormone antibody can be used in various applications, including Western blotting, immunohistochemistry, and flow cytometry. Its ability to bind to specific epitopes on the growth hormone molecule allows for precise detection and quantification. Additionally, this monoclonal antibody has been found to have neutralizing properties, inhibiting the biological activity of growth hormone. With its wide range of potential applications and proven efficacy, the Human Growth Hormone antibody is a valuable tool for researchers studying growth hormone-related processes such as adipose tissue development, bone growth, and metabolism regulation.

Mouse monoclonal APBB3 antibody

<p>SPATA5 antibody was raised using the middle region of SPATA5 corresponding to a region with amino acids ALLALEEDIQANLIMKRHFTQALSTVTPRIPESLRRFYEDYQEKSGLHTL</p>

Akt, also known as Protein Kinase B (PKB), is a serine/threonine-specific kinase crucial for regulating key cellular functions, including growth, survival, metabolism, and proliferation. It operates within the PI3K/Akt/mTOR pathway, which integrates external signals to maintain cellular function and adaptation. Humans express three Akt isoforms—Akt1, Akt2, and Akt3—each encoded by a distinct gene. The activation of Akt generally starts when external signals like growth factors or insulin bind to cell surface receptors, activating phosphoinositide 3-kinase (PI3K). This leads to the production of phosphatidylinositol (3,4,5)-trisphosphate (PIP3) on the cell membrane, which attracts Akt to the membrane, where it undergoes phosphorylation at two specific sites, Thr308 and Ser473, to become fully active. Once activated, Akt moves through the cell to phosphorylate target proteins involved in various cellular pathways.The primary functions of Akt include promoting cell survival by inhibiting apoptosis through the inactivation of pro-apoptotic proteins like BAD and Caspase-9. It also supports cell growth and proliferation by activating mTOR, a central regulator of protein synthesis, while suppressing growth-arrest pathways. Akt plays a key role in metabolic regulation by increasing glucose uptake and glycolysis, largely through GLUT4 translocation and hexokinase activation, which is particularly important in muscle and fat tissues. It contributes to angiogenesis by upregulating VEGF expression, aiding tissue growth and repair, and it promotes cell migration, facilitating wound healing as well as the spread of cancer cells in malignancy. Due to its broad role in cell survival and growth, Akt is often hyperactivated in cancers, driving unchecked cell division and tumor growth, which makes the PI3K/Akt/mTOR pathway a target for many cancer therapies. Additionally, Akt's role in glucose metabolism links it to insulin signaling, where defects can impair glucose uptake, leading to insulin resistance and type 2 diabetes.

The CCL2 antibody is a highly effective inhibitor that belongs to the class of monoclonal antibodies. It works by neutralizing the activity of CCL2, a chemokine involved in inflammation and immune response. This antibody can be immobilized on various surfaces such as vitronectin-coated plates or electrodes for use in research and diagnostic applications in the field of Life Sciences. The CCL2 antibody has been shown to effectively block the binding of CCL2 to its receptor, thereby preventing the recruitment of immune cells to inflammatory sites. Additionally, it has been demonstrated to inhibit protease activity associated with CCL2 signaling pathways. This antibody is compatible with human serum and exhibits high specificity towards CCL2, making it an ideal tool for studying the role of this chemokine in various biological processes.

<p>HSD17B11 antibody was raised in Rabbit using Human HSD17B11 as the immunogen</p>

CCDC52 antibody was raised using the N terminal of CCDC52 corresponding to a region with amino acids TVTDLTVHRATPEDLVRRHEIHKSKNRALVHWELQEKALKRKWRKQKPET

<p>Rat monoclonal CD94 antibody (PE)</p>

<p>The LC3 antibody is a growth factor monoclonal antibody that is commonly used in assays for cytotoxicity. It is widely used in the field of Life Sciences and has applications in various research areas. The LC3 antibody specifically targets antibodies that are involved in phosphatase and 3-kinase signaling pathways, making it an essential tool for studying these processes. Additionally, the LC3 antibody can be used to detect acetylation patterns on tyrosine kinase receptors and extracellular histones. Researchers also utilize this antibody to investigate the effects of inhibitors on these pathways. With its high specificity and reliability, the LC3 antibody is an indispensable tool for any researcher working in the field of Life Sciences.</p>

Rabbit polyclonal CTNND1 antibody

<p>The GPRC5D antibody is an essential tool for immunoassays and research in the field of Life Sciences. This antibody specifically targets GPRC5D, a receptor protein that plays a role in various biological processes. It can be used in a wide range of applications, including binding studies, protein detection, and characterization. The GPRC5D antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options to suit their specific needs. With its high specificity and affinity, this antibody ensures accurate and reliable results. Whether you are studying autoantibodies or developing antigen binding molecules, the GPRC5D antibody is an invaluable resource for your research endeavors. Trust in its exceptional performance and choose this antibody for your next project in Life Sciences.</p>

<p>The STAT1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to the STAT1 protein, which plays a crucial role in cell signaling and immune response. This antibody can be used in various applications, such as Western blotting, immunofluorescence, and immunohistochemistry.</p>

Troponin I antibody (cardiac) was raised in mouse using amino acid residues 86-90 of cTnI as the immunogen.

Rabbit polyclonal Hemoglobin antibody (biotin)

<p>Rat monoclonal CIRE antibody (PE)</p>

<p>The TES antibody is a highly specialized monoclonal antibody that targets and binds to the TRPV4 antigen. This antibody is widely used in life sciences research, particularly in the study of interferon signaling pathways. It has been proven effective in detecting and quantifying TRPV4 expression levels in various experimental settings.</p>

<p>Mouse monoclonal PSMB4 antibody</p>

<p>Rabbit polyclonal WAVE1 antibody (Tyr125)</p>

<p>Rabbit polyclonal XPO6 antibody</p>

TKTL2 antibody was raised using the N terminal of TKTL2 corresponding to a region with amino acids QLTSCCSAAEVVSVLFFHTMKYKQTDPEHPDNDRFILSRGHAAPILYAAW