Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,394 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PSA antibody
<p>PSA antibody is a monoclonal antibody that specifically targets prostate-specific antigen (PSA) in human serum. It is widely used in Life Sciences research and diagnostics, particularly in the field of prostate cancer. This antibody recognizes and binds to PSA, a glycoprotein that is produced by the prostate gland. The binding of the PSA antibody to PSA can be used for various applications, including immunoassays, immunohistochemistry, and western blotting. Additionally, this antibody has been modified with fatty acid or other acid modifications to improve its stability and performance. The PSA antibody can be immobilized on surfaces such as electrodes or cellulose for use in biosensors or diagnostic devices. It has also shown potential therapeutic effects, as it can interfere with the growth factor signaling pathways associated with prostate cancer progression.</p>Ezrin antibody
<p>The Ezrin antibody is a highly specific monoclonal antibody that targets ezrin, a protein involved in cell adhesion and signaling. It has been shown to have high specific activity in neutralizing the function of ezrin. This antibody can be used in various applications in the Life Sciences field, including research on alpha-fetoprotein and annexin A2. It is also effective in inhibiting the production of superoxide, a reactive oxygen species involved in oxidative stress. The Ezrin antibody can be used as a valuable tool for studying cell biology and investigating the role of ezrin in various cellular processes.</p>R spondin1 antibody
<p>R spondin1 antibody was raised in Mouse using a purified recombinant fragment of RSPO1 expressed in E. coli as the immunogen.</p>KCNA7 antibody
<p>KCNA7 antibody was raised using the C terminal of KCNA7 corresponding to a region with amino acids GEEAGMFSHVDMQPCGPLEGKANGGLVDGEVPELPPPLWAPPGKHLVTEV</p>COX7B antibody
<p>COX7B antibody was raised using the N terminal of COX7B corresponding to a region with amino acids MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI</p>TBC1D21 antibody
<p>TBC1D21 antibody was raised using the N terminal of TBC1D21 corresponding to a region with amino acids MTTLSPENSLSARQSASFILVKRKPPIDKTEWDSFFDESGHLAKSRDFIC</p>DLAT antibody
<p>DLAT antibody was raised using a synthetic peptide corresponding to a region with amino acids WTPSSGATPRNRLLLQLLGSPGRRYYSLPPHQKVPLPSLSPTMQAGTIAR</p>NUDT6 antibody
<p>NUDT6 antibody was raised in rabbit using the middle region of NUDT6 as the immunogen</p>ATG2A antibody
<p>ATG2A antibody was raised using a synthetic peptide corresponding to a region with amino acids PRRGPAPGAADSQSWASCMTTSLQLAQECLRDGLPEPSEPPQPLEGLEMF</p>C9ORF68 antibody
<p>C9ORF68 antibody was raised using the middle region of C9Orf68 corresponding to a region with amino acids CLDSSQFGKSSSSKQGDADFHGKASFATYQHSTSPGPLDQPLLRERFHPG</p>RSU1 antibody
<p>RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK</p>Annexin A1 antibody
<p>Annexin A1 antibody was raised using the N terminal of ANXA1 corresponding to a region with amino acids WFIENEEQEYVQTVKSSKGGPGSAVSPYPTFNPSSDVAALHKAIMVKGVD</p>BCAT1 antibody
<p>The BCAT1 antibody is a highly specialized antibody that plays a crucial role in various biological processes. It is commonly used in Life Sciences research and has proven to be effective in studying the receptor binding of certain substances. This antibody is particularly useful in the field of oncology, as it can help researchers understand the mechanisms behind cancer growth and potentially develop targeted therapies.</p>HIV1 p24 antibody
<p>HIV1 p24 antibody was raised in mouse using HIV1 p24 (native antigen) as the immunogen.</p>PEG10 antibody
<p>PEG10 antibody was raised in Mouse using a purified recombinant fragment of PEG10(aa1-120) expressed in E. coli as the immunogen.</p>GluR1 antibody
<p>The GluR1 antibody is an activated antibody that targets glutamate receptors in the brain. It has been shown to inhibit the activity of insulin and butyrylcholinesterase, which are enzymes involved in glucose metabolism and neurotransmitter regulation. This antibody can be used in various research applications, such as immunohistochemistry and Western blotting, to study the expression and localization of GluR1 receptors. Additionally, it can be used in life sciences research to investigate the role of GluR1 receptors in neuronal signaling pathways and synaptic plasticity. The GluR1 antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs.</p>VDAC1 antibody
<p>VDAC1 antibody was raised using the C terminal of VDAC1 corresponding to a region with amino acids SAKVNNSSLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA</p>FZD8 antibody
<p>The FZD8 antibody is a highly specialized antibody that targets the epidermal growth factor receptor. This antibody is designed to specifically bind to FZD8, a protein involved in the Wnt signaling pathway. By binding to FZD8, the antibody inhibits the activation of β-catenin and downstream signaling events, ultimately leading to a decrease in cell proliferation and growth.</p>CD3 antibody (FITC)
<p>CD3 antibody (FITC) was raised in mouse using chicken CD3 as the immunoge.</p>GAB2 antibody
<p>The GAB2 antibody is a highly effective tool for researchers in the field of Life Sciences. This recombinant antibody specifically targets and binds to GAB2, an important protein involved in various cellular processes. The GAB2 antibody can be used for a wide range of applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>LAL antibody
<p>LAL antibody was raised in Mouse using a purified recombinant fragment of LAL expressed in E. coli as the immunogen.</p>
