Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,394 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75081 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
GUSB antibody
<p>GUSB antibody was raised using the C terminal of GUSB corresponding to a region with amino acids VLGNKKGIFTRQRQPKSAAFLLRERYWKIANETRYPHSVAKSQCLENSPF</p>SYP antibody
<p>The SYP antibody is a highly specialized antibody that targets the Synaptophysin protein. Synaptophysin is a glycoprotein that is found in high concentrations in neuroendocrine cells and neurons. It plays a crucial role in neurotransmitter release and synaptic vesicle exocytosis.</p>SRA antibody
<p>SRA antibody was raised in Mouse using a purified recombinant fragment of SRA expressed in E. coli as the immunogen.</p>MALT1 antibody
<p>The MALT1 antibody is a highly specialized antibody that targets specific proteins in the body. It is commonly used in various assays and research studies within the field of Life Sciences. This antibody specifically binds to serum albumin protein, which plays a crucial role in transporting various molecules throughout the body. Additionally, it has been shown to interact with growth factors, such as EGF-like proteins, which are involved in cell proliferation and differentiation.</p>HMGCL antibody
<p>HMGCL antibody was raised using a synthetic peptide corresponding to a region with amino acids WVPQMGDHTEVLKGIQKFPGINYPVLTPNLKGFEAAVAAGAKEVVIFGAA</p>STEAP1 antibody
<p>The STEAP1 antibody is a highly specialized antibody that targets the phosphatase STEAP1. This antibody has cytotoxic properties and has been shown to disrupt actin filaments, leading to cell death. It is available as both polyclonal and monoclonal antibodies, offering researchers a range of options for their experiments. In the field of Life Sciences, this antibody is widely used for its neutralizing effects on STEAP1 activity. The monoclonal antibody variant has been specifically designed to be activated upon binding to STEAP1, ensuring optimal performance in immunoassays. With its high affinity and specificity, this antibody can be used in various applications such as Western blotting, immunofluorescence, and flow cytometry. Researchers can rely on the STEAP1 antibody to accurately detect and measure the levels of this important glycoprotein in their experiments.</p>OTUB1 antibody
<p>OTUB1 antibody was raised using the middle region of OTUB1 corresponding to a region with amino acids KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK</p>PAH antibody
<p>The PAH antibody is a monoclonal antibody that specifically targets the molecule of interest. It is commonly used in bioassays and research studies within the field of Life Sciences. This antibody has been proven to be highly effective in detecting and quantifying the presence of PAH (polycyclic aromatic hydrocarbon) in various samples.</p>DR3 antibody
<p>The DR3 antibody is a monoclonal antibody that specifically targets adipose tissue. It has been shown to bind to estradiol, a hormone that plays a crucial role in regulating body fat distribution. The DR3 antibody also exhibits high sensitivity to C-reactive protein, an inflammatory marker commonly used to assess cardiovascular health. Studies have demonstrated that the DR3 antibody can inhibit syncytia formation, a process involved in the spread of viral infections. Additionally, it has proteolytic activity and can act as a serine protease inhibitor. This versatile medicament holds promise for various applications in the field of medicine and research.</p>VAMP1 antibody
<p>The VAMP1 antibody is a powerful medicament that belongs to the class of Antibodies. It is specifically designed to target and neutralize the growth factor VAMP1, which plays a crucial role in various cellular processes. This antibody binds to the messenger RNA (mRNA) of VAMP1, preventing its translation into protein and inhibiting its function.</p>APE1 antibody
<p>The APE1 antibody is a highly specific monoclonal antibody that targets endoplasmic reticulum aminopeptidase 1 (APE1). It is used in Life Sciences research to study the role of APE1 in various cellular processes. This antibody has been shown to neutralize the activity of APE1, which is involved in DNA repair and redox regulation. It can be used for immunoprecipitation, Western blotting, and immunofluorescence experiments. The APE1 antibody has been validated using mass spectrometric methods and has been shown to specifically recognize APE1 in nuclear extracts. It can also be immobilized on an electrode for use in electrochemical assays. With its high specificity and versatility, the APE1 antibody is an essential tool for researchers studying growth factors, signal transduction pathways, and DNA repair mechanisms.</p>CD29 antibody
<p>The CD29 antibody is a highly reactive monoclonal antibody that specifically targets the serum albumin protein. It acts as an agonist protein, activating various cellular processes. This antibody has been shown to bind to thyroglobulin and growth factors, making it an essential tool in cell antigen research. It is commonly used in the field of Life Sciences for studying autoantibodies and chemokines.</p>CACNB1 antibody
<p>CACNB1 antibody was raised using the N terminal of CACNB1 corresponding to a region with amino acids DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS</p>Lp (a) antibody
<p>Lp (a) antibody was raised in rabbit using the middle region of LPA as the immunogen</p>CXORF34 antibody
<p>CXORF34 antibody was raised using the middle region of Cxorf34 corresponding to a region with amino acids GAACGLTSLYFQESTMTRCSHQQSPYQLLFGEPYIFEELLSLKIRISPDA</p>p53 antibody
<p>The p53 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to target and bind to the p53 protein, which is a nuclear protein that plays a crucial role in regulating cell growth and preventing tumor formation. This stable polymorph antibody can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry.</p>
