Primary Antibodies

<p>FUT6 antibody was raised in Rabbit using Human FUT6 as the immunogen</p>

<p>The Lamin A Antibody is a highly effective cytotoxic agent used in Life Sciences research. This antibody specifically targets human hepatocytes and immobilizes them, allowing for accurate and reliable assays. It is a monoclonal antibody that binds to the antigen transthyretin, inhibiting its activity and preventing interference with experimental results. The Lamin A Antibody has been extensively tested and shown to be activated by interferon, making it an ideal tool for studying immune responses. With its high specificity and affinity for its target, this monoclonal antibody is a valuable asset in any laboratory setting.</p>

<p>Rabbit polyclonal GPR126 antibody</p>

<p>Desmoglein 1/2 antibody was raised in mouse using “Band 3” polypeptide of isolated desmosomes from bovine muzzle epidermis as the immunogen.</p>

<p>Ctp Synthase antibody was raised using the C terminal of CTPS corresponding to a region with amino acids FGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINH</p>

<p>Rabbit polyclonal RPS14 antibody (FITC)</p>

<p>EVL antibody was raised in Rabbit using Human EVL as the immunogen</p>

<p>SYNCRIP antibody was raised using the N terminal of SYNCRIP corresponding to a region with amino acids MATEHVNGNGTEEPMDTTSAVIHSENFQTLLDAGLPQKVAEKLDEIYVAG</p>

<p>Purified Polyclonal PPHLN1 antibody</p>

<p>CD97 antibody was raised in Rabbit using Human CD97 as the immunogen</p>

<p>DAK antibody was raised in Rabbit using Human DAK as the immunogen</p>

<p>TFF1 antibody is a monoclonal antibody that specifically targets alpha-fetoprotein. It is commonly used in life sciences research to study the role of TFF1 in various biological processes. The antibody can be used in different applications, such as immunohistochemistry and Western blotting, to detect and quantify TFF1 levels. Additionally, TFF1 antibody can be utilized in experiments involving hydrogen fluoride polymers, antibodies immobilized on electrodes, or monolayer cultures. This versatile tool allows researchers to investigate the function of TFF1 and its interactions with other molecules, such as protein kinases or glucagon inhibitors. With its high specificity and sensitivity, the TFF1 antibody is an essential component for any study involving TFF1-related mechanisms.</p>

<p>DKK3 antibody was raised in Mouse using a purified recombinant fragment of human DKK3 expressed in E. coli as the immunogen.</p>

<p>MGC3207 antibody was raised in rabbit using the N terminal of MGC3207 as the immunogen</p>

<p>The RANK antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets the receptor activator of nuclear factor kappa-B (RANK), which plays a crucial role in various biological processes such as bone remodeling, immune system regulation, and mammary gland development. The RANK antibody is highly specific and has been validated for use in multiple applications including Western blotting, immunohistochemistry, and flow cytometry.</p>

<p>The Lysozyme antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and detects lysozyme, an enzyme found in various biological systems. This antibody can be used in a wide range of applications, including androgen assays, immunohistochemistry, Western blotting, and ELISA.</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. By binding to DNA-dependent RNA polymerase, this drug inhibits bacterial growth by preventing transcription and replication. Its potency has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Metabolized through various metabolic transformations, including hydrolysis, oxidation, reduction, and conjugation, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth. Trust 6-Fluoro-3-indoxyl-beta-D-galactopyranoside for its remarkable effectiveness against tuberculosis.</p>

<p>Rabbit polyclonal NGAL antibody (HRP)</p>

<p>PPP1R7 antibody was raised using a synthetic peptide corresponding to a region with amino acids QNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN</p>

<p>FLT1 antibody was raised in Rabbit using Human FLT1 as the immunogen</p>

<p>TBC1D22A antibody was raised using the N terminal of TBC1D22A corresponding to a region with amino acids RQGRPTLQEGPGLQQKPRPEAEPPSPPSGDLRLVKSVSESHTSCPAESAS</p>

<p>FMR1 antibody was raised in Mouse using a purified recombinant fragment of human FMR1 expressed in E. coli as the immunogen.</p>

<p>Affinity purified Mouse polyclonal XRCC1 antibody</p>

<p>AADAC antibody was raised using a synthetic peptide corresponding to a region with amino acids NYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGL</p>

<p>ARHGEF19 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFLLNSVLYQEYSDVASARELRRQQREEEGPGDEAEGAEEGPGPPRANLS</p>

<p>CHRNB2 antibody was raised using a synthetic peptide corresponding to a region with amino acids CKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWD</p>

<p>BLK antibody was raised in Mouse using a purified recombinant fragment of BLK expressed in E. coli as the immunogen.</p>

<p>ATE1 antibody was raised in Rabbit using Human ATE1 as the immunogen</p>

<p>Purified Polyclonal POLR3C antibody</p>

<p>VDAC3 antibody was raised using the N terminal of VDAC3 corresponding to a region with amino acids KWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKRDCF</p>

<p>Please enquire for more information about CXCL9 antibody (Biotin) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Rabbit polyclonal DLEC1 antibody</p>

<p>NONO antibody was raised using the C terminal of NONO corresponding to a region with amino acids DGTLGLTPPTTERFGQAATMEGIGAIGGTPPAFNRAAPGAEFAPNKRRRY</p>

<p>The ORC2 antibody is a highly effective tool in the field of life sciences. It is an activated polyclonal antibody that specifically targets endocytic uptake. This antibody can be used in various applications, including immunohistochemistry, western blotting, and flow cytometry. The ORC2 antibody is also available as a monoclonal antibody for more specific targeting. It has been extensively tested and proven to have high affinity and specificity for its target antigen. Additionally, this antibody has been found to be highly effective in neutralizing the cytotoxic effects of certain pathogens, such as Bacillus thuringiensis. Its colloidal properties allow for easy conjugation with other molecules, making it a versatile tool for research purposes. With its ability to interfere with interferon signaling pathways and modulate fatty acid metabolism, the ORC2 antibody opens up new possibilities for studying these biological processes.</p>

<p>Flt1 antibody was raised in mouse using recombinant human FLT1/VEGFR1 protein EC-domain as the immunogen.</p>

<p>Rabbit polyclonal Aldolase antibody (HRP)</p>

<p>Rabbit Polyclonal elF4E antibody (Ser209)</p>

<p>C3orf33 antibody was raised using the middle region of C3orf33 corresponding to a region with amino acids NSALFCYLLVSKGGYFSVNLNEEILRRGLGKTVLVKGLKYDSKIYWTVHR</p>

<p>ARMC8 antibody was raised in Rabbit using Human ARMC8 as the immunogen</p>

<p>ABCG4 antibody was raised in Rabbit using Human ABCG4 as the immunogen</p>

<p>Affinity purified Rabbit polyclonal Neuregulin 2 antibody</p>

<p>Rabbit polyclonal Claudin 6 antibody (Tyr219)</p>

<p>Purified Rabbit polyclonal MADS92 antibody</p>

<p>BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.</p>

<p>The APLP2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets the APLP2 protein, which plays a crucial role in various biological processes. The APLP2 antibody is designed to recognize and bind to specific regions of the APLP2 protein, allowing for precise detection and analysis.</p>

<p>TARC antibody (biotin) was raised in rabbit using highly pure recombinant human TARC as the immunogen.</p>

<p>ABAT antibody was raised in Rabbit using Human ABAT as the immunogen</p>

<p>Rabbit polyclonal NADAP antibody</p>

<p>FUT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EATPWKDFALLTQCNHTIMTIGTFGFWAAYLAGGDTVYLANFTLPDSEFL</p>

<p>MCSF antibody was raised in Rabbit using Human MCSF as the immunogen</p>