Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,566 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75302 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FOXRED1 antibody
<p>FOXRED1 antibody was raised using the N terminal of FOXRED1 corresponding to a region with amino acids SEIKKKIKSILPGRSCDLLQDTSHLPPEHSDVVIVGGGVLGLSVAYWLKK</p>RPS4X antibody
<p>The RPS4X antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets the sn-38 molecule, which is known for its cytotoxic properties. This antibody has been extensively tested and proven to be highly effective in neutralizing the activity of sn-38.</p>HDAC1 antibody
<p>The HDAC1 antibody is a monoclonal antibody that specifically targets and binds to the histone deacetylase 1 (HDAC1) protein. This antibody is commonly used in life sciences research to study the function and regulation of HDAC1. It can be used for various applications including immunohistochemistry, western blotting, and enzyme-linked immunosorbent assays (ELISA). The HDAC1 antibody is highly specific and has been validated for use in human hepatocytes. It recognizes both the amino-terminal and carboxyl-terminal regions of HDAC1, making it a versatile tool for studying different aspects of HDAC1 biology. This antibody is biotinylated and can be easily detected using streptavidin-conjugated secondary antibodies. With its high affinity and specificity, the HDAC1 antibody is an essential tool for researchers studying epigenetics, gene expression regulation, and chromatin remodeling.</p>ACAT2 antibody
<p>ACAT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SREDQDKVAVLSQNRTENAQKAGHFDKEIVPVLVSTRKGLIEVKTDEFPR</p>6X His tag Antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This active compound works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, thus preventing bacterial growth. Extensive research has been conducted on human erythrocytes using the patch-clamp technique, demonstrating its high frequency of human activity. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Furthermore, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their cell</p>SOCS3 antibody
The SOCS3 antibody is a highly effective histone deacetylase inhibitor that has shown promising results in various medical applications. This monoclonal antibody acts by targeting and neutralizing the activity of p38 MAPK, a protein involved in the regulation of immune responses. By inhibiting p38 MAPK, the SOCS3 antibody helps to modulate inflammatory processes and reduce tissue damage.CD2 antibody (biotin)
<p>CD2 antibody (biotin) was raised in rat using CD2/LFA-2 as the immunogen.</p>ADH1B antibody
<p>ADH1B antibody was raised using a synthetic peptide corresponding to a region with amino acids NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV</p>PLXDC2 antibody
<p>The PLXDC2 antibody is a monoclonal antibody that specifically targets and binds to the PLXDC2 protein. This protein is found on the surface of granulosa cells and plays a crucial role in various biological processes related to growth factor signaling. The PLXDC2 antibody can be used in Life Sciences research to study the function and regulation of this protein.</p>FZD7 antibody
<p>The FZD7 antibody is a powerful tool used in Life Sciences research. It specifically targets the Frizzled-7 receptor, which plays a crucial role in the development and function of catecholaminergic neurons. This antibody is widely used to study the activation and signaling pathways of FZD7 in various cellular processes.</p>ADAT1 antibody
<p>ADAT1 antibody was raised using the C terminal of ADAT1 corresponding to a region with amino acids RLVPCGAAISWSAVPEQPLDVTANGFPQGTTKKTIGSLQARSQISKVELF</p>KLHDC8A antibody
<p>KLHDC8A antibody was raised using the C terminal of KLHDC8A corresponding to a region with amino acids PGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGLSDAVEALCVSDS</p>PNKP antibody
<p>PNKP antibody was raised using the N terminal of PNKP corresponding to a region with amino acids MGEVEAPGRLWLESPPGGAPPIFLPSDGQALVLGRGPLTQVTDRKCSRTQ</p>JAK1 antibody
<p>The JAK1 antibody is a potent inhibitor that targets pluripotent stem cells. It is a substance that forms an acid complex and can be dissolved in hexane. This antibody has been shown to effectively inhibit cell proliferation by blocking the phosphorylation of peptide nucleic acids. It is widely used in the field of Life Sciences as an activation agent for various applications. Additionally, the JAK1 antibody has shown promising potential as an anticancer agent. Its high-quality production and purity make it a reliable choice for researchers in need of polyclonal antibodies.</p>PPM1B antibody
<p>The PPM1B antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the PPM1B protein, which is involved in various cellular processes such as fibrinogen metabolism, helicobacter infection, and peptide nucleic acid synthesis. This antibody has been extensively tested and proven to be highly effective in blocking the activity of PPM1B, making it an essential tool for researchers studying the role of this protein in various biological systems.</p>NDRG1 antibody
<p>NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG</p>FBP1 antibody
<p>FBP1 antibody was raised using the N terminal of FBP1 corresponding to a region with amino acids YVVCFDPLDGSSNIDCLVSVGTIFGIYRKKSTDEPSEKDALQPGRNLVAA</p>GLRX5 antibody
<p>GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG</p>
