Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
BTN1A1 antibody
The BTN1A1 antibody is a monoclonal antibody that specifically targets the BTN1A1 protein. It is commonly used in Life Sciences research and has a wide range of applications. This antibody can be used as an inhibitor to study the function of the BTN1A1 protein in various cellular processes. It is also widely used in immunoassays to detect and quantify the presence of BTN1A1 in samples such as human serum. The BTN1A1 antibody has shown cytotoxic activity against cells expressing high levels of BTN1A1, making it a potential therapeutic option for diseases associated with abnormal BTN1A1 expression. Additionally, this antibody can be used in combination with other monoclonal antibodies, such as anti-DNP antibodies or anti-HER2 antibodies, to enhance their efficacy and target specific signaling pathways involving growth factors like epidermal growth factor (EGF).PLAT antibody
<p>PLAT antibody was raised using the middle region of PLAT corresponding to a region with amino acids TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR</p>PGM5 antibody
<p>PGM5 antibody was raised in rabbit using the N terminal of PGM5 as the immunogen</p>FGFR1 antibody
FGFR1 antibody was raised in Mouse using purified recombinant extracellular fragment of human FGFR1(aa33-423) fused with hIgGFc tag expressed in HEK293 cells as the immunogen.NAGS antibody
<p>NAGS antibody was raised using the C terminal of NAGS corresponding to a region with amino acids YLDKFVVSSSRQGQGSGQMLWECLRRDLQTLFWRSRVTNPINPWYFKHSD</p>PLOD3 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an exceptional antituberculosis drug that falls under the class of rifamycins. With its bactericidal activity and potent ability to inhibit bacterial growth, it is considered one of the most effective treatments for tuberculosis infections. This active compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Moreover, this drug specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting cell growth in culture.DLG4 antibody
<p>DLG4 antibody was raised using a synthetic peptide corresponding to a region with amino acids AAHLHPIAIFIRPRSLENVLEINKRITEEQARKAFDRATKLEQEFTECFS</p>RanBP1 antibody
RanBP1 antibody was raised using the C terminal of RANBP1 corresponding to a region with amino acids KFEECRKEIEEREKKAGSGKNDHAEKVAEKLEALSVKEETKEDAEEKQCDK2 antibody
<p>The CDK2 antibody is a monoclonal antibody that belongs to the family of kinase inhibitors. It is used in Life Sciences research to study the growth factor signaling pathways and their role in various cellular processes. The CDK2 antibody specifically targets and neutralizes the activity of cyclin-dependent kinase 2 (CDK2), an enzyme involved in cell cycle regulation. By inhibiting CDK2, this antibody can block the proliferation of cancer cells and other cell types.</p>Crystallin Zeta antibody
<p>Crystallin Zeta antibody was raised using a synthetic peptide corresponding to a region with amino acids KGIDIIIEMLANVNLSKDLSLLSHGGRVIVVGSRGTIEINPRDTMAKESS</p>PDCD8 antibody
<p>PDCD8 antibody was raised in rabbit using the N terminal of PDCD8 as the immunogen</p>PIK3CA antibody
<p>The PIK3CA antibody is a polyclonal antibody that targets the PIK3CA gene, which encodes the p110α subunit of phosphatidylinositol 3-kinase (PI3K). This antibody is commonly used in life sciences research to study the role of PIK3CA in various cellular processes. It has been shown to inhibit protease activity and mitogen-activated protein kinase (MAPK) signaling pathway, both of which are involved in cell proliferation and survival. The PIK3CA antibody exhibits high substrate specificity for its target and has strong DNA binding activity. It is commonly used in flow immunoassays to detect activated PIK3CA in primary cells. Additionally, this antibody has neutralizing properties against interleukin-6 (IL-6), an inflammatory cytokine involved in various diseases. Whether you're studying signal transduction pathways or investigating therapeutic targets, the PIK3CA antibody is an essential tool for your research needs</p>LRRC50 antibody
<p>LRRC50 antibody was raised using the N terminal of LRRC50 corresponding to a region with amino acids LNDTLYLHFKGFDRIENLEEYTGLRCLWLQSNGIQKIENLEAQTELRCLF</p>SIX1 antibody
The SIX1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the protein SIX1, which plays a crucial role in various biological processes, including development, cell growth, and differentiation. This antibody can be used to detect and quantify the levels of SIX1 in human serum samples or tissue sections.TMOD1 antibody
<p>The TMOD1 antibody is a compound that inhibits serotonin, adeno-associated virus, and heparin. It is commonly used in Life Sciences research and has been shown to inhibit the activity of heparin cofactor. This polyclonal antibody targets specific polypeptides and can be used in the development of new medicines. With its inhibiting properties, the TMOD1 antibody is a valuable tool for researchers studying various biological processes.</p>ASPH antibody
<p>ASPH antibody was raised using the N terminal of ASPH corresponding to a region with amino acids SEVLQGKLGIYDADGDGDFDVDDAKVLLEGPSGVAKRKTKAKVKELTKEE</p>LYK5 antibody
<p>LYK5 antibody was raised using the C terminal of LYK5 corresponding to a region with amino acids AEELTMSPSRSVANSGLSDSLTTSTPRPSNGDSPSHPYHRTFSPHFHHFV</p>POU2F1 antibody
<p>The POU2F1 antibody is a highly specialized monoclonal antibody that targets the growth factor POU2F1. This antibody has been extensively tested and validated for use in various assays, including those involving human serum and adipose tissue. It specifically recognizes the tyrosine residues of the nuclear POU2F1 protein, allowing for its easy detection and immobilization in experiments.</p>
