Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
C3orf49 antibody
<p>C3orf49 antibody was raised using the middle region of C3orf49 corresponding to a region with amino acids IQLDVVEAETEEITQGNTLLRARRTTKRLSVTSLPSGLQKGPYSPKKRPH</p>TIMP2 antibody
<p>The TIMP2 antibody is a polyclonal antibody that is used in immunohistochemistry to detect the presence of TIMP2 (Tissue Inhibitor of Metalloproteinase 2) in various biological samples. This antibody specifically binds to the CXCR4 antigen, which is an acidic chemokine receptor involved in cell migration and immune response. The TIMP2 antibody can be immobilized on an electrode or used as a probe in various assays to study the activation and function of CXCR4. Additionally, this antibody has been used in antibody-drug conjugates for targeted therapy in cancer treatment. In life sciences research, the TIMP2 antibody is a valuable tool for studying the role of TIMP2 in cellular processes and disease progression, such as interferon signaling and transthyretin-related disorders.</p>TEAD2 antibody
<p>TEAD2 antibody was raised in mouse using recombinant Human Tea Domain Family Member 2</p>Estrogen Receptor alpha antibody
<p>The Estrogen Receptor alpha antibody is a highly specialized serine protease that is commonly used in Life Sciences. This antibody is colloidal in nature and belongs to the class of Polyclonal Antibodies. It has been specifically designed to target the estrogen receptor alpha, which plays a crucial role in various biological processes.</p>FBXO3 antibody
<p>FBXO3 antibody was raised using the N terminal of FBXO3 corresponding to a region with amino acids NCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYS</p>TEAD3 antibody
<p>TEAD3 antibody is a valuable product in the field of Life Sciences. This antibody is widely used in research and pharmaceutical industries for its ability to detect and bind to TEAD3 protein. TEAD3 is an important transcriptional regulator that plays a crucial role in various cellular processes, including development, differentiation, and disease progression. The TEAD3 antibody is highly specific and sensitive, making it an ideal tool for studying the function and regulation of TEAD3 in different biological systems.</p>PTER antibody
<p>PTER antibody was raised in rabbit using the N terminal of PTER as the immunogen</p>CCT5 antibody
<p>CCT5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESEE</p>ODC antibody
<p>ODC antibody is a polyclonal antibody that specifically targets and binds to ornithine decarboxylase (ODC), a protein involved in the synthesis of polyamines. Polyamines play important roles in cell growth, proliferation, and differentiation. ODC antibody can be used in various applications in life sciences research, including the study of epidermal growth factor signaling pathways, autoantibodies associated with diseases such as heparin-induced thrombocytopenia, and the development of anti-HER2 antibody therapies. This antibody can also be used to detect ODC expression levels in different tissues or cell lines. The high specificity and sensitivity of ODC antibody make it an essential tool for researchers studying the role of polyamines in cellular processes and their potential as therapeutic targets.</p>Caspase 7 antibody
<p>The Caspase 7 antibody is a highly specialized antibody that plays a crucial role in various biological processes. This polyclonal antibody specifically targets caspase 7, an enzyme involved in programmed cell death (apoptosis). It is widely used in life sciences research to study the mechanisms of apoptosis and its regulation.</p>Aflatoxin antibody
The Aflatoxin antibody is a protein inhibitor that belongs to the class of Monoclonal Antibodies. It acts as a growth factor and can be used in various applications such as research in Life Sciences. This antibody specifically targets aflatoxins, which are toxic compounds produced by certain molds that contaminate food and feed crops. By binding to aflatoxins, the antibody prevents their harmful effects on human and animal health.5HT2B antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has been conducted on its human activity using a patch-clamp technique on human erythrocytes. The metabolization process involves hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and effectively inhibits their cell growth in culture.</p>CEP350 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, effectively stopping bacterial growth. Its efficacy has been proven through extensive research using the patch-clamp technique on human erythrocytes. The active form of this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds to markers highly expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.</p>WNT10B antibody
<p>WNT10B antibody was raised in Mouse using a purified recombinant fragment of human WNT10B expressed in E. coli as the immunogen.</p>Bovine RBC antibody (FITC)
Bovine RBC antibody (FITC) was raised in rabbit using bovine reythrocytes as the immunogen.SRPR antibody
<p>SRPR antibody was raised using a synthetic peptide corresponding to a region with amino acids DSEKAKKPVRSMIETRGEKPKEKAKNSKKKGAKKEGSDGPLATSKPVPAE</p>ARHGAP25 antibody
<p>ARHGAP25 antibody was raised using the middle region of ARHGAP25 corresponding to a region with amino acids SPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL</p>DDX3Y antibody
<p>The DDX3Y antibody is a polyclonal antibody that has minimal toxicity and is widely used in the field of Life Sciences. It plays a crucial role in various biological processes, including colony-stimulating factor production, chemokine signaling, and immune response modulation. This antibody can be used for cytometry analysis to detect the presence of DDX3Y protein in cells or tissues.</p>KCTD15 antibody
<p>KCTD15 antibody was raised in mouse using recombinant human KCTD15 (1-234) purified from E.coli as the immunogen.</p>KIF22 antibody
<p>KIF22 antibody was raised using the C terminal of KIF22 corresponding to a region with amino acids LASQGSQGAPLLSTPKRERMVLMKTVEEKDLEIERLKTKQKELEAKMLAQ</p>Cytokeratin 19 antibody
<p>The Cytokeratin 19 antibody is a highly effective polyclonal antibody that targets and binds to Cytokeratin 19, a protein that plays a crucial role in cell adhesion and differentiation. This antibody has been extensively tested and proven to be reliable in detecting the presence of Cytokeratin 19 in various biological samples.</p>E. coli 0157:H7 antibody (FITC)
<p>E. coli 0157:H7 antibody (FITC) was raised in goat using whole cells of E. coli serotype 0157:H7 as the immunogen.</p>
