Primary Antibodies

<p>The OLC1 antibody is a monoclonal antibody that specifically targets vasoactive intestinal peptide (VIP). VIP is a neuropeptide that plays a crucial role in various physiological processes, including immune regulation, neurotransmission, and inflammation. This antibody has been extensively studied in the field of life sciences and has shown promising results in the modulation of immune responses.</p>

<p>The ERO1L antibody is a polyclonal antibody used in Life Sciences research. It specifically targets the ERO1L protein, which plays a crucial role in the regulation of cellular redox balance. This antibody has been shown to neutralize the activity of ERO1L, making it an essential tool for studying the function and mechanisms of this biomolecule. Additionally, the ERO1L antibody can be used to investigate the interactions between ERO1L and other proteins, such as galectin-3, collagen, and myelin-associated glycoprotein. With its high specificity and affinity, this monoclonal antibody is a valuable asset in multidrug research and understanding various cellular processes involving steroid and glucagon signaling. Researchers can rely on the ERO1L antibody to provide accurate and reliable results in their experiments.</p>

<p>MAP4 antibody was raised in rabbit using the N terminal of MAP4 as the immunogen</p>

<p>Mouse monoclonal C3a desArg antibody</p>

<p>Phencyclidine antibody was raised in mouse using phencyclidine (PCP)-BSA as the immunogen.</p>

<p>The Tau antibody is a powerful tool in the field of Life Sciences. It belongs to the group of antibodies that are capable of neutralizing multidrug resistance and TGF-beta. This antibody can be used as both a polyclonal and monoclonal antibody, depending on the specific needs of the experiment or study. It has been extensively tested and validated, ensuring its reliability and accuracy.</p>

<p>Rabbit polyclonal SYNCRIP antibody (FITC)</p>

Mouse monoclonal CRTC3 antibody

<p>CNOT2 antibody was raised in mouse using recombinant Human Ccr4-Not Transcription Complex, Subunit 2 (Cnot2)</p>

<p>PABPN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGL</p>

<p>UBE2J2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GIQLLNGHAPGAVPNLAGLQQANRHHGLLGGALANLFVIVGFAAFAYTVK</p>

<p>The GRIA2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind specifically to the GRIA2 protein, which plays a crucial role in various cellular processes including fas-mediated apoptosis, collagen synthesis, and growth factor signaling.</p>

TTC14 antibody was raised using the N terminal of TTC14 corresponding to a region with amino acids LLSLLRSEQQDNPHFRSLLGSAAEPARGPPPQHPLQGRKEKRVDNIEIQK

<p>The ADAM32 antibody is a monoclonal antibody that specifically targets collagen. It is derived from the plant Gynura procumbens and has been extensively studied in the field of Life Sciences. This antibody has shown promising results as an HDAC inhibitor, which can have potential therapeutic applications in various diseases. Additionally, it has been investigated for its role as a vaccine strain and its ability to modulate the immune response. The ADAM32 antibody is widely used in research and development of new medicines, as well as in the production of other antibodies. Its unique properties make it a valuable tool for studying protein-protein interactions, methyl transferase activity, and β-catenin signaling pathways. Polyclonal Antibodies and inhibitors targeting 6-phosphogluconate dehydrogenase have also been developed using this antibody.</p>

<p>The MEK2 antibody is a highly specialized monoclonal antibody that specifically targets and binds to the MEK2 protein. This antibody is activated upon contact with cellulose, allowing for enhanced binding affinity and specificity. It has been extensively tested and proven to effectively neutralize the activity of MEK2 in various biological systems.</p>

<p>Rabbit polyclonal POU3F3 antibody</p>

<p>Mouse monoclonal Cytokeratin 10+13 antibody</p>

<p>The PNPase antibody is a valuable tool in Life Sciences research. It is a polyclonal antibody that specifically targets the alpha-synuclein protein. This antibody can be used for various applications, including Western blotting, immunohistochemistry, and immunofluorescence.</p>

<p>KAP23.1 antibody was raised using the middle region of KRTAP23-1 corresponding to a region with amino acids CEGYLCYSGYSRGGSSYPSNLVYSTEPLISQHLPAGFLSLQGLSGDLLGN</p>

<p>Rabbit polyclonal Catenin alpha antibody</p>

<p>Rabbit polyclonal TMEM11 antibody</p>

<p>Purified Polyclonal Topoisomerase 3 beta antibody</p>

<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Metabolically, it undergoes various transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>

<p>Purified Polyclonal CLCN4 antibody</p>

<p>Rabbit Polyclonal Tau antibody (Ser214)</p>

<p>Purified Rabbit polyclonal OR52N1 antibody</p>

<p>The Tyrosine Hydroxylase antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets and detects tyrosine hydroxylase, an enzyme involved in the synthesis of dopamine, a neurotransmitter that plays a crucial role in various physiological processes. The Tyrosine Hydroxylase antibody recognizes an epitope located within the protein sequence of tyrosine hydroxylase, allowing for precise and accurate detection.</p>

The SARS-CoV-2 Spike Antibody is an acidic monoclonal antibody that has been developed for the detection and neutralization of the spike protein of the SARS-CoV-2 virus. This antibody specifically targets the spike protein, which plays a crucial role in viral entry into host cells. By binding to the spike protein, this antibody prevents the virus from attaching to and infecting healthy cells.

<p>Purified Polyclonal cJun antibody</p>

<p>The E Cadherin antibody is a highly specialized product in the field of Life Sciences. It is an essential tool for researchers studying cell adhesion and signaling pathways. This antibody specifically targets E-cadherin, a protein that plays a crucial role in cell-cell adhesion and tissue integrity.</p>

<p>CHORDC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SGVPIFHEGMKYWSCCRRKTSDFNTFLAQEGCTKGKHMWTKKDAGKKVVP</p>

<p>Yersinia enterocolitica O:9 antibody was raised in mouse using Yersinia enterocolitica serogroup O:9 strain as the immunogen.</p>

<p>The AP3B1 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and bind to the AP3B1 protein, which plays a crucial role in intracellular vesicle trafficking. This antibody has been extensively tested and validated for its specificity and sensitivity.</p>

<p>Mouse monoclonal KATNB1 antibody</p>

<p>Goat anti-mouse IgM (biotin) (mu chain specific) was raised in goat using mouse IgM, Mu-chain as the immunogen.</p>

<p>C14ORF130 antibody was raised using the N terminal Of C14Orf130 corresponding to a region with amino acids MAGAEGAAGRQSELEPVVSLVDVLEEDEELENEACAVLGGSDSEKCSYSQ</p>

<p>Mouse monoclonal NIF3L1 antibody</p>

<p>Rabbit polyclonal NPR2 antibody</p>

<p>The JAK2 antibody is a highly effective inhibitor that targets the nuclear tyrosine kinase, JAK2. This monoclonal antibody blocks the activity of JAK2, preventing its interaction with other signaling molecules and inhibiting the downstream effects of JAK2 activation. By doing so, it disrupts the signaling pathway involved in various cellular processes, including glutamate and insulin metabolism.</p>

<p>Affinity purified Rabbit polyclonal NNT1 antibody</p>

<p>The POLR2A antibody is a highly specific and potent antibody that targets the glycine residues in the POLR2A protein. It is commonly used in life sciences research, specifically in studies involving antibodies and their interactions with various proteins. This polyclonal antibody has been shown to have neuroprotective properties and can be used to study the activation of growth factors such as trastuzumab, dopamine, and epidermal growth factor. Additionally, it can be utilized to investigate the binding of hormone peptides and binding proteins. With its high specificity and potency, the POLR2A antibody is an invaluable tool for researchers in the field of life sciences.</p>

MAPK3 antibody was raised in mouse using recombinant human MAPK3 protein (1-137aa) purified from E. coli as the immunogen.

<p>C16ORF71 antibody was raised using the middle region of C16Orf71 corresponding to a region with amino acids KASACARKVPADTPQDTKEADSGSRCASRKQGSQAGPGPQLAQGMRLNAE</p>

Rabbit polyclonal GRIN1 antibody (Splice Variant C1)

<p>CHES1 antibody was raised in mouse using recombinant Checkpoint Suppressor 1 (Ches1)</p>

<p>SEC23B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI</p>

<p>Affinity purified Rabbit polyclonal CYFIP2 antibody</p>

<p>Rabbit polyclonal AKAP5 antibody</p>

<p>Rabbit polyclonal PSMB5 antibody</p>

<p>Purified Polyclonal Carboxypeptidase N1 antibody</p>