Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,624 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75324 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PARP2 antibody
<p>The PARP2 antibody is a cytotoxic monoclonal antibody used in Life Sciences research. It is designed to target and bind to the PARP2 protein, which plays a crucial role in DNA repair and cell survival. This antibody can be immobilized on an electrode or used in various assays to study the interaction between PARP2 and other molecules.</p>CBR1 antibody
<p>The CBR1 antibody is a highly specific and potent antibody that targets CBR1, an enzyme involved in various cellular processes. This antibody is widely used in life sciences research and has applications in fields such as epidermal growth factor signaling, adipose tissue biology, and serotonin metabolism. It can be used to study the role of CBR1 in different cellular pathways and to investigate its potential as a therapeutic target. The CBR1 antibody is available as a polyclonal antibody and has been validated for use in various experimental techniques, including immunohistochemistry, Western blotting, and ELISA. With its high specificity and sensitivity, this antibody is a valuable tool for researchers looking to explore the functions of CBR1 in different biological systems.</p>PSAP antibody
<p>The PSAP antibody is a growth factor antigen that plays a crucial role in various biological processes. It is an essential tool in the field of Life Sciences, particularly in antibody research. The PSAP antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>CAPZA3 antibody
<p>CAPZA3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGEC</p>NAT13 antibody
<p>NAT13 antibody was raised using the C terminal of NAT13 corresponding to a region with amino acids AIDFYRKFGFEIIETKKNYYKRIEPADAHVLQKNLKVPSGQNADVQKTDN</p>LIX1L antibody
LIX1L antibody was raised using a synthetic peptide corresponding to a region with amino acids AGSPAVLREAVEAVVRSFAKHTQGYGRVNVVEALQEFWQMKQSRGADLKNGPR101 antibody
<p>The GPR101 antibody is a high-quality antibody that is designed to neutralize the activity of GPR101, a protein complex involved in various biological processes. This antibody is produced using advanced techniques and has been extensively tested for its specificity and effectiveness. It has been shown to effectively bind to GPR101 in human serum, making it an ideal tool for research in the field of Life Sciences. The GPR101 antibody can be used in a variety of applications, including Western blotting, immunohistochemistry, and ELISA assays. With its exceptional performance and reliability, this antibody is a valuable asset for scientists studying GPR101 and related proteins such as c-myc, fibronectin, collagen, globulin, telomerase, alpha-fetoprotein, and more. Choose the GPR101 antibody for accurate and reliable results in your experiments.</p>HSD17B14 antibody
<p>HSD17B14 antibody was raised using a synthetic peptide corresponding to a region with amino acids QPAEVGAAAVFLASEANFCTGIELLVTGGAELGYGCKASRSTPVDAPDIP</p>IGF2BP2 antibody
The IGF2BP2 antibody is a highly specific monoclonal antibody used in Life Sciences research. It is an inhibitor that targets IGF2BP2, a biomolecule and serum marker involved in various cellular processes. This antibody is designed to specifically bind to IGF2BP2, making it an essential tool for studying its function and regulation. It can be used in experiments involving human enzymes, such as those found in mesenchymal stem cells. The IGF2BP2 antibody is a reliable and effective tool for researchers looking to explore the role of this growth factor and develop potential therapeutic interventions.SULF2 antibody
<p>SULF2 antibody was raised using the C terminal of SULF2 corresponding to a region with amino acids DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYEQYRQFQRRKW</p>GFAP antibody
GFAP antibody was raised in Mouse using a purified recombinant fragment of human GFAP expressed in E. coli as the immunogen.QTRT1 antibody
<p>QTRT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids FMPVGTQATMKGITTEQLDALGCRICLGNTYHLGLRPGPELIQKANGLHG</p>CES3 antibody
<p>CES3 antibody was raised in rabbit using the C terminal of CES3 as the immunogen</p>Chlamydia trachomatis antibody (FITC)
<p>Chlamydia trachomatis antibody (FITC) was raised in rabbit using L2 and other serovar groups as the immunogen.</p>SERPINA1 antibody
<p>The SERPINA1 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor known as SERPINA1. This antibody has been extensively studied and proven to be cytotoxic against cells that express high levels of SERPINA1, making it a valuable tool in cancer research and therapy. Additionally, this antibody has shown binding affinity to collagen, hepatocyte growth factor, chemokines, interferons, and androgen-binding proteins, indicating its potential in various areas of life sciences research. With its exceptional specificity and potency, the SERPINA1 antibody offers great promise for advancing our understanding of cellular processes and developing new therapeutic strategies.</p>14-3-3 beta antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is particularly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, inhibiting transcription and replication, which ultimately leads to bacterial growth inhibition. The high frequency of human activity has been demonstrated using a patch-clamp technique on human erythrocytes. Additionally, this drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. It also specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>ANKRD2 antibody
<p>ANKRD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSL</p>Caspase 8 antibody
<p>The Caspase 8 antibody is a highly effective inhibitor that targets the growth factor superoxide. This monoclonal antibody is designed to specifically neutralize caspase 8, a key enzyme involved in cell death pathways. By blocking the activity of caspase 8, this antibody prevents the initiation of apoptotic processes and promotes cell survival.</p>NRBF2 antibody
<p>NRBF2 antibody was raised using the N terminal of NRBF2 corresponding to a region with amino acids KKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERL</p>Desmocollin 1 antibody
Desmocollin 1 antibody was raised in mouse using synthetic peptide corresponding to sequence present within the intracellular part of human desmocollin 1 as the immunogen.SYNCRIP antibody
<p>SYNCRIP antibody was raised using the middle region of SYNCRIP corresponding to a region with amino acids IEIVFAKPPDQKRKERKAQRQAAKNQMYDDYYYYGPPHMPPPTRGRGRGG</p>
