Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CD127 antibody
<p>CD127 antibody is a polyclonal antibody that targets the TGF-beta protein. It is commonly used in life sciences research to study collagen and other related proteins. This antibody can be used in various applications, such as polymerase chain reaction (PCR), hybridization, and cytotoxic assays. CD127 antibody specifically binds to TGF-beta1 and can be used to detect its presence in samples. Additionally, this antibody has been shown to have an inhibitory effect on lectins, which are glycan-binding proteins. CD127 antibody is also known to promote the growth of human hepatocytes and exhibit natriuretic properties. Overall, this versatile antibody is a valuable tool for researchers studying TGF-beta signaling pathways and related biological processes.</p>PEX5 antibody
<p>The PEX5 antibody is a monoclonal antibody that targets fibronectin, a growth factor involved in various cellular processes. This antibody specifically binds to PEX5, a protein involved in peroxisome biogenesis and function. It has been shown to inhibit endothelial cell growth and proliferation, making it a potential therapeutic option for diseases characterized by abnormal blood vessel formation. Additionally, the PEX5 antibody has demonstrated efficacy as a multidrug combination therapy when used in conjunction with other targeted therapies, such as epidermal growth factor inhibitors or anti-HER2 antibodies like trastuzumab. Its ability to modulate signaling pathways involving β-catenin and VEGF-C further highlights its potential applications in life sciences research. With its high specificity and affinity for its target, the PEX5 antibody offers valuable insights into peroxisome biology and holds promise for future therapeutic interventions.</p>PLXDC2 antibody
<p>The PLXDC2 antibody is a highly specialized monoclonal antibody that has been developed for use in the field of Life Sciences. It is designed to specifically target and neutralize the activity of PLXDC2, a glycoconjugate receptor involved in various cellular processes. This antibody has been shown to be cytotoxic against cells expressing high levels of PLXDC2, making it a promising tool for targeted therapy.</p>Factor VIIIc antibody
<p>Factor VIIIc antibody was raised in mouse using human factor VIII antigen as the immunogen.</p>Septin 9 antibody
<p>The Septin 9 antibody is a highly specialized monoclonal antibody that targets a specific cell antigen. It has been extensively studied in the field of pluripotent stem cells and has shown promising results in various applications. This antibody has been used in research studies involving the treatment of cancer with doxorubicin, as well as in polymerase chain reactions (PCR) to detect specific messenger RNA molecules.</p>IGJ antibody
<p>The IGJ antibody is a monoclonal antibody that specifically targets insulin in the human body. It is designed to bind to insulin molecules and prevent their interaction with insulin receptors, thereby inhibiting their activity. This antibody is commonly used in Life Sciences research to study the role of insulin in various physiological processes.</p>FBXL4 antibody
FBXL4 antibody was raised in mouse using recombinant Human F-Box And Leucine-Rich Repeat Protein 4 (Fbxl4)Giardia lamblia antibody
The Giardia lamblia antibody is a monoclonal antibody that has been developed for use in the field of Life Sciences. It is specifically designed to target and bind to Giardia lamblia, a common parasite that causes gastrointestinal infections in humans. This antibody works by recognizing and binding to specific proteins on the surface of Giardia lamblia, effectively neutralizing its activity and preventing further infection.EIF4G3 antibody
<p>EIF4G3 antibody was raised using the middle region of EIF4G3 corresponding to a region with amino acids MRGGSSKDLLDNQSQEEQRREMLETVKQLTGGVDVERNSTEAERNKTRES</p>BCKDK antibody
BCKDK antibody was raised using the N terminal of BCKDK corresponding to a region with amino acids CLPFIIGCNPTILHVHELYIRAFQKLTDFPPIKDQADEAQYCQLVRQLLDANXA3 antibody
ANXA3 antibody is a monoclonal antibody that targets mesothelin, a growth factor that is overexpressed in various types of cancer. This antibody specifically binds to mesothelin and neutralizes its activity, inhibiting tumor growth and metastasis. ANXA3 antibody has been shown to have high specificity and affinity for mesothelin, making it an effective tool for diagnostic assays and potential therapeutic applications. Additionally, this antibody can be used in research studies to investigate the role of mesothelin in cancer development and progression. Overall, ANXA3 antibody offers promise as a valuable tool in the fight against cancer.Adiponectin antibody
Adiponectin antibody was raised in mouse using recombinant human adiponectin (15-244aa) purified from E. coli as the immunogen.C5ORF24 antibody
<p>C5ORF24 antibody was raised using the middle region of C5Orf24 corresponding to a region with amino acids SIEIKDELKKKKNLNRSGKRGRPSGTTKSAGYRTSTGRPLGTTKAAGFKT</p>CCNB1 antibody
<p>CCNB1 antibody was raised in Mouse using a purified recombinant fragment of human CCNB1 expressed in E. coli as the immunogen.</p>BECN1 antibody
<p>The BECN1 antibody is a monoclonal antibody that specifically targets the epidermal growth factor-like domain of BECN1. It has been shown to neutralize the activity of TNF-α, a pro-inflammatory cytokine involved in various diseases. This specific antibody can inhibit the binding of TNF-α to its receptor and prevent downstream signaling pathways associated with inflammation. In addition, the BECN1 antibody has been found to block the interaction between growth factors and fibronectin, inhibiting cell migration and proliferation. It also shows potential in modulating chemokine expression and regulating TGF-beta signaling. With its wide range of applications in life sciences, this antibody holds promise for research and therapeutic purposes in collagen-related diseases and other inflammatory conditions.</p>TECK antibody
TECK antibody was raised in mouse using highly pure recombinant human TECK as the immunogen.Carbonic Anhydrase IV antibody
<p>Carbonic Anhydrase IV antibody was raised using the middle region of CA4 corresponding to a region with amino acids DGEHFAMEMHIVHEKEKGTSRNVKEAQDPEDEIAVLAFLVEAGTQVNEGF</p>STAG2 antibody
<p>The STAG2 antibody is a polypeptide used in Life Sciences research. It is a polyclonal antibody that specifically targets the STAG2 antigen. This antibody is commonly used in studies involving nucleic acids and can be used to detect and analyze various nucleic acid molecules. Its high specificity and sensitivity make it an essential tool for researchers working in the field of molecular biology and genetics. With its wide range of applications, the STAG2 antibody is a valuable asset for any laboratory or research facility.</p>SOD3 antibody
<p>The SOD3 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize the activity of Superoxide Dismutase 3 (SOD3), an enzyme involved in oxidative stress regulation. This antibody can be used as a research tool to study the role of SOD3 in various biological processes.</p>NAP1L1 antibody
NAP1L1 antibody was raised in mouse using recombinant Human Nucleosome Assembly Protein 1-Like 1
