Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,776 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Rat Thymocyte antibody
Rat thymocyte antibody was raised in rabbit using RBC-free rat thymocytes as the immunogen.CD171 antibody
The CD171 antibody is a monoclonal antibody that specifically binds to the CD171 receptor. It is commonly used in life sciences research to study the functions and interactions of CD171 and its binding proteins. This antibody can be used as an inhibitor to block the activity of CD171 or as a tool to detect and measure the expression levels of CD171 in various samples. The CD171 antibody has also been used in studies related to TNF-α, collagen, GLP-1, cystatin, autoantibodies, hybridization, and other antigen binding molecules. With its high specificity and affinity, the CD171 antibody is a valuable tool for researchers in the field of antibodies and molecular biology.RNF25 antibody
RNF25 antibody was raised using the middle region of RNF25 corresponding to a region with amino acids CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGGASCC2 antibody
The ASCC2 antibody is a highly specialized antibody that targets specific molecules in the body. It has been shown to have cytotoxic effects, meaning it can destroy harmful cells. This antibody is particularly effective against viruses, as it can neutralize virus surface antigens and prevent their replication. Additionally, the ASCC2 antibody has been found to enhance the activity of interferon-gamma, an important immune system molecule that helps fight off infections. This antibody also plays a role in regulating protein kinase activity and can influence various cellular processes. With its ability to target specific molecules and promote immune responses, the ASCC2 antibody is a valuable tool in life sciences research.Peripherin antibody
Peripherin antibody is a highly effective recombination activated antibody that has been widely used in the Life Sciences field. This monoclonal antibody specifically targets and inhibits adrenergic receptor agonists, which play a crucial role in various physiological processes. By binding to these receptors, the Peripherin antibody effectively blocks their activity, providing researchers with a valuable tool for studying the function of these receptors.TNF alpha antibody
<p>TNF alpha antibody is a glycoprotein that contains sugar moieties and belongs to the epidermal growth factor (EGF)-like family. It acts as a growth factor and plays a crucial role in various biological processes. This antibody specifically targets TNF-α, a pro-inflammatory cytokine involved in immune responses and inflammatory diseases.</p>TLR4 antibody
<p>The TLR4 antibody is a reactive and neutralizing monoclonal antibody that targets Toll-like receptor 4 (TLR4). It is commonly used in research and clinical settings to study the role of TLR4 in various biological processes. This antibody specifically binds to TLR4, preventing its interaction with ligands and downstream signaling molecules. By blocking TLR4 activation, the antibody inhibits the production of pro-inflammatory cytokines such as interleukin-6 (IL-6) and tumor necrosis factor-alpha (TNF-α). Additionally, it has been shown to inhibit the genotoxic effects of certain substances, making it a valuable tool in genotoxicity studies. The TLR4 antibody is widely used in life sciences research, particularly in the fields of immunology and inflammation. Whether you're studying cholinergic signaling or investigating fatty acid metabolism, this antibody can provide valuable insights into cellular processes regulated by TLR4. Choose our high-quality TLR4 antibody for your</p>RAD51AP1 antibody
<p>RAD51AP1 antibody was raised using the middle region of RAD51AP1 corresponding to a region with amino acids EDDVGGVQGKRKAASKAAAQQRKILLEGSDGDSANDTEPDFAPGEDSEDD</p>YTHDF1 antibody
The YTHDF1 antibody is a highly specialized antibody used in the field of Life Sciences. It is designed to specifically target and bind to YTHDF1, a protein involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific needs.RPS9 antibody
<p>The RPS9 antibody is a growth factor that activates the 3-kinase and protein kinase pathways. It is a monoclonal antibody that specifically targets RPS9, a protein involved in ribosome biogenesis. This antibody has been shown to have a high affinity for RPS9 and can be used as a research tool to study its function in various cellular processes.</p>SMARCA4 antibody
SMARCA4 antibody was raised in mouse using recombinant Swi/Snf Related, Matrix Associated, Actin Dependent Regulator Of Chromatin, Subfamily A, Member 4 (Smarca4)CA 125 antibody
<p>CA 125 antibody was raised in mouse using purified human ovarian mucin antigen from ascitic fluid as the immunogen.</p>CD253 antibody
<p>The CD253 antibody is a highly specialized monoclonal antibody that targets mesothelin, a protein involved in various cellular processes. This antibody is widely used in Life Sciences research to study the function and regulation of mesothelin. It binds specifically to mesothelin and can be used for various applications such as immunoassays, immunohistochemistry, and flow cytometry.</p>YWHAZ antibody
<p>YWHAZ antibody was raised using the C terminal of YWHAZ corresponding to a region with amino acids AFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAGEGGE</p>Plasminogen antibody (HRP)
Plasminogen antibody (HRP) was raised in goat using human plasminogen purified from plasma as the immunogen.NRL antibody
<p>The NRL antibody is a highly effective inhibitor used in various applications within the Life Sciences field. It is a monoclonal antibody that specifically targets and binds to the NRL protein. This antibody can be used for immobilization purposes, such as in immunoassays, where it can be attached to an electrode for quantitation of NRL protein levels. Additionally, the NRL antibody has shown potential in the treatment and/or prophylaxis of certain conditions associated with abnormal NRL expression or autoantibodies against NRL. With its high specificity and affinity, this antibody offers a valuable tool for researchers and scientists working in the field of molecular biology and diagnostics.</p>VDAC2 antibody
<p>VDAC2 antibody was raised using the N terminal of VDAC2 corresponding to a region with amino acids MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV</p>NEK6 antibody
The NEK6 antibody is a highly specialized neurotrophic factor that has natriuretic properties. It belongs to the class of Life Sciences globulins and is known for its reactive nature. This antibody has neutralizing and inhibitory properties against TGF-β1, making it an effective tool in research and therapeutic applications. The NEK6 antibody is a monoclonal antibody, which means it is produced by a single clone of cells and exhibits high specificity for its target. It has been extensively studied for its cholinergic effects and has shown promising results as a potential medicament. Additionally, this monoclonal antibody interacts with sphingosine, further enhancing its therapeutic potential. Choose the NEK6 antibody for your research needs and unlock new possibilities in the field of neurobiology.BSG antibody
<p>The BSG antibody is a highly specialized product in the field of Life Sciences. It belongs to the category of chemokine antibodies and is specifically designed to target and bind to activated BSG (Basigin) proteins. This monoclonal antibody exhibits high affinity and specificity for BSG, making it an ideal tool for various research applications.</p>
