Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,764 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CEA antibody
The CEA antibody is a monoclonal antibody that specifically targets the carcinoembryonic antigen (CEA), a glycoprotein that is highly expressed in certain types of cancer cells. This antibody works by neutralizing the epidermal growth factor (EGF) and preventing its binding to the EGF receptor, thus inhibiting cell growth and proliferation.SCML2 antibody
SCML2 antibody was raised in mouse using recombinant Human Sex Comb On Midleg-Like 2 (Drosophila) (Scml2)XRCC4 antibody
<p>XRCC4 antibody was raised using the middle region of XRCC4 corresponding to a region with amino acids LQKENERLLRDWNDVQGRFEKCVSAKEALETDLYKRFILVLNEKKTKIRS</p>CPA1 antibody
<p>The CPA1 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets and neutralizes tumor necrosis factor-alpha (TNF-α), a protein involved in inflammatory responses. This antibody has shown efficacy in blocking the activity of TNF-α, which plays a crucial role in various diseases and conditions. Studies have also demonstrated that the CPA1 antibody can inhibit the production of interleukin-6 and interferon, both of which are involved in immune responses. Additionally, this monoclonal antibody has been shown to bind to transferrin, a biomolecule involved in iron transport, as well as nuclear receptors. The CPA1 antibody holds promise for therapeutic applications due to its ability to target specific proteins and disrupt protein complexes involved in disease pathogenesis.</p>C-peptide antibody
<p>The C-peptide antibody is a monoclonal antibody that specifically targets the C-peptide protein in human serum. This antibody has been extensively studied for its potential role in cellular protein synthesis and as an inhibitor of certain reactions. In laboratory settings, the C-peptide antibody has demonstrated cytotoxic effects on cells expressing high levels of the target protein. Additionally, this antibody has been used to investigate calcium binding and mineralization processes in various experimental models, including liver microsomes. The C-peptide antibody can be a valuable tool for researchers studying autoantibodies or histidine-related biological processes. Its high specificity and affinity make it an excellent choice for applications requiring precise detection and quantification of the C-peptide protein.</p>ApoA-I antibody
ApoA-I antibody was raised in Mouse using a purified recombinant fragment of human APOA1 expressed in E. coli as the immunogen.KBTBD8 antibody
<p>KBTBD8 antibody was raised in rabbit using the N terminal of KBTBD8 as the immunogen</p>CD54 antibody
The CD54 antibody is a highly specific antigen-binding protein that belongs to the group of polyclonal and monoclonal antibodies. It is widely used in life sciences research for its ability to target and bind to CD54, also known as intercellular adhesion molecule-1 (ICAM-1). This glycoprotein plays a crucial role in cell-to-cell interactions and immune response modulation.TGF β 1 antibody
The TGF beta 1 antibody is a monoclonal antibody that specifically targets the growth factor TGF-beta 1. This antibody is reactive and can be used in various applications within the Life Sciences field. It has been shown to be effective in neutralizing the activity of TGF-beta 1, which plays a crucial role in cell proliferation, differentiation, and immune response regulation. The TGF beta 1 antibody is polymorphic, meaning it can recognize different forms of the target protein due to its specificity for specific epitopes. It has been successfully used in experiments involving imatinib-treated human serum samples, where it demonstrated its ability to detect activated TGF-beta 1. This antibody can be utilized in techniques such as immunoblotting and electrophoresis to study the expression and function of TGF-beta 1 in various biological systems.cMyc antibody
The cMyc antibody is a highly specialized molecule drug used in Life Sciences research. It plays a crucial role in various biological processes, including cell proliferation, differentiation, and apoptosis. This antibody specifically targets the cMyc protein, which is involved in regulating gene expression.MTHFD1 antibody
MTHFD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CMAKTHLSLSHNPEQKGVPTGFILPIRDIRASVGAGFLYPLVGTMSTMPGHPRT antibody
HPRT antibody was raised in Mouse using a purified recombinant fragment of HPRT expressed in E. coli as the immunogen.Dengue NS1 antibody
<p>The Dengue NS1 antibody is a cytotoxic monoclonal antibody that belongs to the class of antibodies known as anti-VEGF (vascular endothelial growth factor). It is widely used in the field of Life Sciences for various applications. This antibody has been shown to have nephrotoxic effects and can be used as an electrode-activated growth factor in endogenous hematopoietic cells. Additionally, it has acidic properties and may interact with insulin, fatty acid, and glucagon receptors. The Dengue NS1 antibody is highly specific and binds to markers expressed at high levels in dengue virus-infected cells, inhibiting viral replication and promoting immune response.</p>CD276 antibody
<p>CD276 antibody was raised in Mouse using a purified recombinant fragment of human CD276 expressed in E. coli as the immunogen.</p>CYP2D6 antibody
<p>CYP2D6 antibody was raised using the N terminal of CYP2D6 corresponding to a region with amino acids RPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLE</p>RPSA antibody
The RPSA antibody is a highly specialized monoclonal antibody that targets the receptor for poliovirus and other viruses. This antibody plays a crucial role in inhibiting viral entry into host cells by blocking the interaction between the virus and its receptor. Additionally, the RPSA antibody has been shown to have antiviral properties against a wide range of viruses, making it an essential tool in virology research and drug development.
