Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,790 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75326 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SARS M antibody
<p>SARS M antibody was raised in Mouse using a purified recombinant fragment of SARS-m protein expressed in E. coli as the immunogen.</p>Thyroglobulin antibody (Prediluted for IHC)
<p>Rabbit polyclonal Thyroglobulin antibody (Prediluted for IHC)</p>Purity:Min. 95%DRB1 antibody
<p>DRB1 antibody was raised using the N terminal of DRB1 corresponding to a region with amino acids MDEAGSSASGGGFRPGVDSLDEPPNSRIFLVISKYTPESVLRERFSPFGD</p>FBXL16 antibody
<p>FBXL16 antibody was raised using the middle region of FBXL16 corresponding to a region with amino acids GCPLLTTTGLSGLVQLQELEELELTNCPGATPELFKYFSQHLPRCLVIE</p>Vimmentin antibody (Prediluted for IHC)
<p>Rabbit polyclonal Vimmentin antibody (Prediluted for IHC)</p>Purity:Min. 95%SQSTM1 antibody
<p>The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. The drug works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Its efficacy has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.</p>MMP19 antibody
<p>MMP19 antibody was raised using the N terminal of MMP19 corresponding to a region with amino acids ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR</p>OSR1 antibody
The OSR1 antibody is a powerful tool in the field of life sciences. It is an interferon and glucagon-neutralizing antibody that has been extensively used in various research studies. This polyclonal antibody specifically targets OSR1 (oxidative stress-responsive 1) protein, which plays a crucial role in cellular processes related to growth, development, and homeostasis.Granzyme A antibody
<p>Granzyme A antibody is a monoclonal antibody that specifically targets and binds to granzyme A, a serine protease enzyme involved in immune response and cell death. This antibody can be used for various applications in the field of Life Sciences, including research on immune system function, cancer therapy, and autoimmune diseases. It has been shown to inhibit the activity of granzyme A by blocking its binding to target cells. Additionally, this antibody has been used in experiments to study the effects of granzyme A on dopamine release, hormone peptide processing, and liver microsome metabolism. With its high specificity and affinity for granzyme A, this monoclonal antibody is a valuable tool for researchers studying immune regulation and cell signaling pathways.</p>SAP155 antibody
The SAP155 antibody is a high-quality polyclonal antibody that is widely used in Life Sciences research. It specifically targets SAP155, a protein that plays a crucial role in various cellular processes such as splicing and gene regulation. This antibody is highly specific and has been extensively validated for its performance in immunohistochemistry, western blotting, and other applications.SSTR2 antibody
<p>The SSTR2 antibody is a highly specialized monoclonal antibody that targets the somatostatin receptor 2 (SSTR2). This antibody has been extensively studied and characterized for its ability to specifically bind to SSTR2, making it an invaluable tool in various research applications.</p>c-Kit antibody
c-Kit antibody was raised in Mouse using a purified recombinant fragment of C-kit expressed in E. coli as the immunogen.KCTD16 antibody
<p>KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSL</p>IL16 antibody
IL16 antibody was raised in Mouse using a purified recombinant fragment of human IL-16 expressed in E. coli as the immunogen.Thioredoxin antibody
<p>Thioredoxin antibody is an essential component in the field of Life Sciences. It is a type of antibody that specifically targets and binds to thioredoxin, a protein involved in various cellular processes. This antibody has been extensively studied for its role in regulating glycosylation, endothelial growth, interferon signaling, enteroendocrine cell function, and caspase-9-mediated apoptosis.</p>NOTCH3 antibody
<p>The NOTCH3 antibody is a powerful tool in the field of Life Sciences. It specifically targets and binds to the activated form of NOTCH3, a growth factor involved in various cellular processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options to suit their specific needs.</p>STK39 antibody
<p>STK39 antibody was raised using a synthetic peptide corresponding to a region with amino acids KYIVNRGEHKNGVLEEAIIATILKEVLEGLDYLHRNGQIHRDLKAGNILL</p>ALDH1L1 antibody
<p>ALDH1L1 antibody was raised using the middle region of ALDH1L1 corresponding to a region with amino acids LTLKAGIPKGVVNVLPGSGSLVGQRLSDHPDVRKIGFTGSTEVGKHIMKS</p>hCG alpha antibody
<p>Based on ELISA, this antibody reacts with alpha subunit of HCG,LH,TSH and FSH .</p>Donkey anti Human IgG (H + L) (Alk Phos)
Donkey anti-human IgG (H + L) (Alk Phos) was raised in donkey using human IgG (H&L) as the immunogen.INSIG2 antibody
<p>INSIG2 antibody was raised using the N terminal of INSIG2 corresponding to a region with amino acids MAEGETESPGPKKCGPYISSVTSQSVNLMIRGVVLFFIGVFLALVLNLLQ</p>Purity:Min. 95%GRB2 antibody
The GRB2 antibody, also known as the Growth Factor Receptor-Bound Protein 2 antibody, is a powerful tool in Life Sciences research. This polyclonal antibody specifically targets GRB2, a protein that plays a crucial role in signal transduction pathways. It is commonly used in studies involving trastuzumab, collagen, alpha-fetoprotein, and other growth factors.
