Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
RNF126 antibody
RNF126 antibody was raised using the N terminal of RNF126 corresponding to a region with amino acids HLFTLPQGYGQFAFGIFDDSFEIPTFPPGAQADDGRDPESRRERDHPSRHDTNB antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycins class. It is specifically designed to combat tuberculosis infection by targeting active compounds and exhibiting bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication, ultimately inhibiting bacterial growth. Extensive research has shown its high efficacy in human erythrocytes using a patch-clamp technique. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it selectively binds to markers expressed in Mycobacterium tuberculosis strains and effectively inhibits their growth in culture.ABCF1 antibody
The ABCF1 antibody is a growth factor that plays a crucial role in various biological processes. It is an essential protein involved in the regulation of histidine and choline acetyltransferase, which are enzymes responsible for neurotransmitter synthesis. This monoclonal antibody specifically targets ABCF1 and can be used in assays to detect its presence or measure its activity. Additionally, it has shown potential as a therapeutic agent in the treatment of conditions such as thrombocytopenia and certain types of cancer, including mcf-7 breast cancer cells. The ABCF1 antibody is widely used in life sciences research and offers valuable insights into cellular signaling pathways and cholinergic systems.STAT5A antibody
The STAT5A antibody is a powerful tool in the field of life sciences. It is a metallic, monoclonal antibody that specifically targets and neutralizes STAT5A, an important protein involved in endothelial growth and various cellular processes. This antibody has been extensively studied and proven to be effective in blocking the activity of STAT5A, thereby inhibiting the growth factor signaling pathways associated with it.SSB antibody
The SSB antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is designed to neutralize specific inhibitors and has been extensively studied for its therapeutic potential. This antibody exhibits unique characteristics including acid modifications, glycosylation, and globulin structure, which contribute to its high specificity and efficacy.MAGEB2 antibody
MAGEB2 antibody was raised using the N terminal of MAGEB2 corresponding to a region with amino acids MPRGQKSKLRAREKRRKARDETRGLNVPQVTEAEEEEAPCCSSSVSGGAALHPP antibody
LHPP antibody was raised using the middle region of LHPP corresponding to a region with amino acids ACGIKAEVVGKPSPEFFKSALQAIGVEAHQAVMIGDDIVGDVGGAQRCGMTUG antibody
TUG antibody was raised in Mouse using a purified recombinant fragment of TUG expressed in E. coli as the immunogen.TAP1 antibody
The TAP1 antibody is a highly specialized antibody that plays a crucial role in the immune system. It is known for its catalase activity, which helps to neutralize harmful substances in the body. This polyclonal antibody has been extensively studied in the field of Life Sciences and has shown great potential as a therapeutic agent.AIMP1 antibody
The AIMP1 antibody is a monoclonal antibody that targets TNF-related apoptosis-inducing protein (TRAIL). It is commonly used in life sciences research and has applications in various fields. The AIMP1 antibody specifically binds to TNF-α, a cytokine involved in inflammation and cell death processes. By targeting TNF-α, the AIMP1 antibody can modulate apoptosis, making it a valuable tool for studying cell signaling pathways and exploring potential therapeutic interventions.
SNAI2 antibody
SNAI2 antibody was raised in Mouse using a purified recombinant fragment of human SNAI2 expressed in E. coli as the immunogen.BTN1A1 antibody
The BTN1A1 antibody is a monoclonal antibody that targets β-catenin, a protein involved in cell adhesion and signaling pathways. This antibody acts as a family kinase inhibitor, preventing the activation of downstream signaling pathways and inhibiting cell growth. It has been shown to be cytotoxic to cancer cells and can enhance the effects of interferon and other growth factor inhibitors. The BTN1A1 antibody specifically recognizes a virus surface antigen expressed on certain cancer cells, making it a valuable tool for targeted therapy. With its high specificity and affinity, this antibody is widely used in life sciences research, particularly in studies related to epidermal growth factor signaling and histidine metabolism. Its versatility and effectiveness make it an essential component in many antibody-based assays and experiments.RABEPK antibody
RABEPK antibody was raised using the N terminal of RABEPK corresponding to a region with amino acids SCSYLPPVGNAKRGKVFIVGGANPNRSFSDVHTMDLGKHQWDLDTCKGLLC6ORF21 antibody
C6ORF21 antibody was raised using the N terminal Of C6Orf21 corresponding to a region with amino acids CSPAAGSFTTLVAQVQVGRPAPDPGKPGRESRLRLLGNYSLWLEGSKEEDEphrin B1 antibody
The Ephrin B1 antibody is a biomolecule that plays a crucial role in cell signaling and growth factor regulation. This antibody specifically targets the alpha-synuclein protein, which is associated with neurodegenerative diseases such as Parkinson's disease. By binding to alpha-synuclein, the Ephrin B1 antibody helps regulate its activity and prevent the formation of toxic aggregates.
PAPOLB antibody
PAPOLB antibody was raised using the N terminal of PAPOLB corresponding to a region with amino acids TDCLLTQRLIETLRPFGVFEEEEELQRRILVLEKLNNLVKEWIREISESKProhibitin 2 antibody
Prohibitin 2 antibody was raised using the N terminal of PHB2 corresponding to a region with amino acids WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR
C2ORF29 antibody
C2ORF29 antibody was raised using the N terminal Of C2Orf29 corresponding to a region with amino acids NPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPEKFFLSQLMLAPTBC1D25 antibody
TBC1D25 antibody was raised using the N terminal of TBC1D25 corresponding to a region with amino acids KVQQVLSWSYGEDVKPFKPPLSDAEFHTYLNHEGQLSRPEELRLRIYHGGSMAD6 antibody
The SMAD6 antibody is a monoclonal antibody that has the ability to neutralize specific virus surface antigens. This antibody specifically targets and binds to the superoxide glucagon receptor, preventing its activation and subsequent signaling cascade. As a result, the antibody inhibits the nuclear translocation of specific antibodies involved in viral replication and immune evasion.SCNN1A antibody
The SCNN1A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the enteroendocrine cells and interferon production. This antibody has been extensively studied for its glycosylation patterns and its ability to induce caspase-9 activation, leading to cell lysis. Additionally, it has shown neutralizing effects on cytotoxic growth factors and anti-DNP antibodies. The viscosity of this antibody solution is optimized for easy handling and storage. Whether you're conducting experiments or performing assays, the SCNN1A antibody is a valuable tool in your research arsenal.
GAL1 antibody
The GAL1 antibody is a highly specialized antibody that targets hepatocyte growth and lipase activity. It belongs to the class of monoclonal antibodies in Life Sciences. This antibody specifically binds to lipoprotein lipase (LPL) and apoa-I, which are key players in lipid metabolism. By targeting these molecules, the GAL1 antibody can modulate lipid levels and potentially have an impact on cardiovascular health. Additionally, this antibody has shown potential as a growth factor for certain cell types, such as endothelial cells, through its interaction with the growth hormone receptor. The GAL1 antibody is available in both monoclonal and polyclonal forms, offering researchers different options for their specific needs.Ubiquilin-Like antibody
Ubiquilin-Like antibody was raised using the middle region of UBQLNL corresponding to a region with amino acids LTQHPATRVIYNSSGGFSSNTSANDTLNKVNHTSKANTAMISTKGQSHIC
