Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
MAS1 antibody
MAS1 antibody was raised using the middle region of MAS1 corresponding to a region with amino acids RPKYQSALVCALLWALSCLVTTMEYVMCIDREEESHSRNDCRAVIIFIAITau antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known for its bactericidal activity against tuberculosis infection. This active compound works by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its effectiveness has been demonstrated through patch-clamp technique on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis, oxidation, reduction, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
KEAP1 antibody
The KEAP1 antibody is a highly specialized monoclonal antibody that belongs to the category of Life Sciences products. It is specifically designed to target and bind to KEAP1, a protein involved in cellular response to oxidative stress. This antibody has been extensively studied and has shown promising results in various research fields.CPN60 antibody
The CPN60 antibody is a highly specialized monoclonal antibody that targets CPN60, a protein involved in various biological processes. It has been extensively studied for its role in interferon signaling and its ability to bind to autoantibodies. This antibody has also shown promising results in inhibiting lipoprotein lipase glycosylation, which is important for lipid metabolism. Furthermore, it has been found to regulate fibroin production and promote fas-mediated apoptosis. The CPN60 antibody is widely used in life sciences research and has become an essential tool for studying protein interactions and cellular processes. Whether you need polyclonal or monoclonal antibodies, the CPN60 antibody is a valuable addition to your laboratory toolkit.POU2F2 antibody
The POU2F2 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the chemokine POU2F2 and can be used for various applications such as immunohistochemistry and Western blotting. This antibody has been shown to neutralize the activity of POU2F2, preventing its interaction with other molecules and inhibiting its function. Additionally, it can be used as a cross-linking agent in experiments involving colloidal antigen-antibody complexes. The POU2F2 antibody has high affinity and specificity, allowing for accurate detection and analysis of POU2F2 in samples. Its activated form has been shown to effectively lyse cells expressing high levels of tumor necrosis factor-alpha (TNF-α) receptors, making it a valuable tool for studying TNF-α signaling pathways.
Prolactin antibody
Prolactin antibody is a highly versatile and potent antibody that has various applications in the field of life sciences. It exhibits antiviral and anticoagulant properties, making it an essential tool for research in these areas. Additionally, this antibody can bind to antiphospholipid antibodies, which are associated with autoimmune disorders such as lupus and antiphospholipid syndrome.PIMT antibody
PIMT antibody was raised in rabbit using residues 839-853 of the C terminus of the PIMT protein as the immunogen.Purity:Min. 95%HNF4G antibody
HNF4G antibody was raised using the N terminal of HNF4G corresponding to a region with amino acids MDMANYSEVLDPTYTTLEFETMQILYNSSDSSAPETSMNTTDNGVNCLCANewcastle disease virus antibody
The Newcastle disease virus antibody is a highly effective monoclonal antibody that is used in the field of Life Sciences. This recombinant virus antibody specifically targets the Newcastle disease virus, a type 2 cytokine that causes respiratory and neurological disorders in birds. The antibody works by binding to specific markers on the virus, preventing its replication and spread within the host. Additionally, this antibody has been shown to have probiotic effects by promoting the growth of beneficial bacteria in the gut. It can be used for various applications such as enzyme labeling, diagnostic assays, and research purposes. With its high specificity and superoxide dismutase activity, this monoclonal antibody is an essential tool for scientists and researchers working in the field of virology.PROM2 antibody
The PROM2 antibody is a highly activated Monoclonal Antibody that is widely used in the Life Sciences field. It specifically targets the PROM2 protein, which plays a crucial role in various cellular processes. This antibody has been shown to have neutralizing and cytotoxic effects on cells expressing PROM2, making it an effective tool for studying its function.
alpha 1 Antichymotrypsin antibody
Alpha-1 antichymotrypsin antibody was raised in mouse using affinity purified alpha-1 antichymotrypsin as the immunogen.PITPNB antibody
PITPNB antibody was raised using the middle region of PITPNB corresponding to a region with amino acids ADRSQVEPADYKADEDPALFQSVKTKRGPLGPNWKKELANSPDCPQMCAYCytokeratin 14 antibody
The Cytokeratin 14 antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets Cytokeratin 14, a protein found in human serum. This antibody is commonly used in research and diagnostic applications to detect the presence of Cytokeratin 14 in various samples.SRC antibody
SRC antibody was raised in Mouse using a purified recombinant fragment of SRC(aa10-193) expressed in E. coli as the immunogen.VTA1 antibody
VTA1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKQLGDNEAITQEIVGCAHLENYALKMFLYADNEDRAGRFHKNMIKSFYT
ACO1 antibody
ACO1 antibody was raised using the N terminal of ACO1 corresponding to a region with amino acids MSNPFAHLAEPLDPVQPGKKFFNLNKLEDSRYGRLPFSIRVLLEAAIRNCGRK6 antibody
The GRK6 antibody is a highly specialized protein that plays a crucial role in regulating cellular processes. It specifically targets alpha-synuclein, a protein associated with neurodegenerative disorders such as Parkinson's disease. By binding to alpha-synuclein, the GRK6 antibody prevents its aggregation and cytotoxic effects, ultimately promoting cell survival.PDIA4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is known to be the most effective among the rifamycins in treating tuberculosis infections. This drug works by inhibiting bacterial growth through its binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its efficacy has been demonstrated through extensive testing using a patch-clamp technique on human erythrocytes.BCAS2 antibody
BCAS2 antibody was raised using the middle region of BCAS2 corresponding to a region with amino acids SKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF
