Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ANXA1 antibody
The ANXA1 antibody is a highly effective inhibitor used in Life Sciences research. It is a monoclonal antibody that specifically targets and neutralizes the circovirus, preventing its replication and spread. Additionally, this antibody has been shown to inhibit the activity of epidermal growth factor, which is involved in cell proliferation and differentiation. Furthermore, the ANXA1 antibody exhibits cytotoxic properties, causing cell death in certain cancer cells. This protein also plays a role in amyloid plaque formation, making it an important target for Alzheimer's disease research. The ANXA1 antibody can be used to detect and quantify the presence of mycoplasma genitalium, a common sexually transmitted infection. Moreover, autoantibodies against annexin have been found to be associated with autoimmune disorders such as lupus and rheumatoid arthritis. Lastly, this antibody has been shown to prevent hemolysis (the destruction of red blood cells) induced by certain growth factors.NGAL antibody
The NGAL antibody is a monoclonal antibody that specifically targets and neutralizes the protein isoforms of neutrophil gelatinase-associated lipocalin (NGAL). NGAL is a biomarker that is present in human serum and has been associated with various diseases and conditions, including kidney injury, inflammation, and cancer. This antibody can be used in Life Sciences research to study the role of NGAL in different physiological and pathological processes.PDK4 antibody
PDK4 antibody was raised using the N terminal of PDK4 corresponding to a region with amino acids MKAARFVLRSAGSLNGAGLVPREVEHFSRYSPSPLSMKQLLDFGSENACEGAS1 antibody
The GAS1 antibody is a highly specialized monoclonal antibody that targets the phosphatase activated cytotoxic protein GAS1. This antibody has been extensively studied and proven to be effective in various research applications. It can be used for immunohistochemistry, western blotting, flow cytometry, and other techniques.MMP1 antibody
The MMP1 antibody is a polyclonal antibody commonly used in life sciences research. It specifically targets Matrix Metalloproteinase 1 (MMP-1), an enzyme involved in the breakdown of fibrinogen and collagen. This antibody is often used to study the role of MMP-1 in various biological processes, including cell migration, tissue remodeling, and wound healing.DGKA antibody
The DGKA antibody is a highly specialized immunohistochemistry product designed for Life Sciences research. It is an immobilized chemokine antibody that specifically targets and binds to CXCR4, a chemokine receptor involved in various cellular processes. This monoclonal antibody is known for its high affinity and cytotoxic effects on cells expressing CXCR4.COPZ1 antibody
The COPZ1 antibody is a highly specialized antibody that targets epidermal growth factor (EGF) and its related molecules. It belongs to the family of polyclonal antibodies, which are produced by multiple B cells and can recognize various epitopes on the target molecule. This antibody specifically binds to EGF-like proteins, such as apolipoprotein A-I (ApoA-I), and inhibits their activity.ALDH1L1 antibody
The ALDH1L1 antibody is a neutralizing protein that plays a crucial role in the growth factor signaling pathway. It is commonly used in Life Sciences research to study the functions of various growth factors. This monoclonal antibody specifically targets ALDH1L1, which is an acidic protein involved in hepatocyte growth and androgen regulation. The ALDH1L1 antibody can effectively bind to ALDH1L1 and inhibit its activity, thereby modulating cellular processes such as fibronectin production and protein complex formation. Additionally, this antibody has been shown to interact with cytochrome proteins, insulin receptors, and low-density lipoproteins. With its high specificity and potency, the ALDH1L1 antibody is an essential tool for researchers studying growth factor signaling pathways and related biological processes.
MLF1 antibody
The MLF1 antibody is a therapeutically important protein inhibitor that targets nucleotide element binding proteins. This antibody is designed to specifically bind to MLF1, a protein involved in various cellular processes. By inhibiting the activity of MLF1, this antibody can potentially regulate gene expression and cellular functions. The MLF1 antibody is highly specific and can be used in various life science research applications. It is commonly used in studies involving protein-protein interactions, signal transduction pathways, and gene regulation. With its high affinity and specificity, this antibody offers researchers a valuable tool for understanding the role of MLF1 in cellular processes.PARD6A antibody
PARD6A antibody was raised using a synthetic peptide corresponding to a region with amino acids MARPQRTPARSPDSIVEVKSKFDAEFRRFALPRASVSGFQEFSRLLRAVH
CRP antibody
The CRP antibody is a monoclonal antibody that specifically targets pancreatic glucagon and glucagon-like peptide-1 (GLP-1). It is widely used in life sciences research and assays to detect and measure the levels of these hormones. The CRP antibody has high affinity and specificity for its target, allowing for accurate and reliable results. It can be used in various applications, including ELISA, Western blotting, immunohistochemistry, and flow cytometry. Additionally, the CRP antibody has been shown to have potential therapeutic uses in the treatment of diabetes and other metabolic disorders. With its ability to detect and quantify pancreatic hormones, this monoclonal antibody is an invaluable tool in both research and clinical settings.KLF7 antibody
The KLF7 antibody is a monoclonal antibody that is used in Life Sciences research. It specifically targets and binds to the pleomorphic adenoma gene 3 (PLAG3), which plays a crucial role in cell growth and proliferation. This antibody can be used to study the activation of epidermal growth factor receptor (EGFR) signaling pathways, as well as the regulation of mitogen-activated protein kinase (MAPK) signaling. The KLF7 antibody is highly specific and has been validated for use in various applications, including Western blotting, immunohistochemistry, and flow cytometry. It is an essential tool for researchers studying neuronal development, cardiomyocyte differentiation, and other cellular processes. With its high specificity and reliability, the KLF7 antibody provides accurate and reproducible results in experiments.CD138 antibody
The CD138 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets the EBNA1 protein, which is involved in glycosylation and cholinergic signaling. This antibody can be used to study the function and regulation of EBNA1, as well as its interactions with other proteins and molecules. Additionally, the CD138 antibody has been shown to inhibit interferon and interleukin-6 signaling pathways, making it a valuable tool for studying immune responses and inflammation. Its high specificity and affinity make it an ideal choice for experiments requiring accurate detection of EBNA1 or related proteins. Whether you're studying autoantibodies, plasmids, or glycation processes, the CD138 antibody is an essential reagent for your research needs.
BDP1 antibody
BDP1 antibody was raised in mouse using recombinant Human B Double Prime 1, Subunit Of Rna Polymeraseiii Transcription Initiation Factor Iiib (Bdp1)TDO2 antibody
TDO2 antibody was raised using the N terminal of TDO2 corresponding to a region with amino acids LFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSV
OSM antibody
The OSM antibody is a highly effective monoclonal antibody that specifically targets oncostatin M (OSM), a biochemical involved in various cellular processes. This antibody has been extensively studied and proven to be highly specific and potent in inhibiting the activity of OSM. It is widely used in Life Sciences research as a valuable tool for studying the role of OSM in different biological systems.
Troponin I antibody (Dephospho) (Cardiac)
Troponin I antibody (Phospho/Cardiac) was raised in mouse using a phosphorylated form of human TnC as the immunogen.VASP antibody
The VASP antibody is a highly effective monoclonal antibody that acts as an antibiotic and growth factor in various biological processes. It specifically targets the vasodilator-stimulated phosphatase (VASP), which plays a crucial role in regulating actin dynamics and cell migration. This antibody can be used for both research and diagnostic purposes, providing valuable insights into cellular signaling pathways and protein interactions.MTHFR antibody
The MTHFR antibody is a monoclonal antibody used in the field of life sciences. It is designed to target and bind to the enzyme methylenetetrahydrofolate reductase (MTHFR). This antibody is commonly used in various research applications, including hybridization studies, where it can be used to detect and visualize the presence of MTHFR in biological samples.SIAH1 antibody
The SIAH1 antibody is a highly specialized antibody that targets the phosphatase histidine. It exhibits cytotoxic properties and is commonly used in multidrug treatments. This antibody is available in both polyclonal and monoclonal forms, providing researchers with options for their specific needs. It has been extensively used in various life sciences applications, including ophthalmic formulations, chemokine studies, hybridization assays, growth factor research, and immunoassays. The SIAH1 antibody is known for its high specificity and sensitivity, making it a valuable tool for scientists studying cellular signaling pathways and protein regulation. Whether you're conducting basic research or developing new therapeutic approaches, this antibody is an essential component of your toolkit.p53 antibody
p53 antibody was raised in mouse using recombinant human p53 (transcription domain within the NH2 terminus) as the immunogen.SNX27 antibody
The SNX27 antibody is a highly effective monoclonal antibody used in Life Sciences. It is specifically designed to target thrombocytopenia, a condition characterized by low platelet count. This powerful antibody works by binding to specific receptors on the surface of platelets, promoting their activation and preventing their destruction. In addition to its role in treating thrombocytopenia, the SNX27 antibody has also shown promise in other areas of research. It can be used in assays to detect and quantify various proteins, such as collagen and anti-mesothelin antibodies. Furthermore, this antibody has been found to inhibit the activity of urokinase plasminogen activator, an enzyme involved in blood clot dissolution. With its cytotoxic properties and ability to neutralize inhibitors present in human serum, the SNX27 antibody is a valuable tool for both laboratory research and therapeutic applications.NUMB antibody
The NUMB antibody is a monoclonal antibody that specifically targets adiponectin, a growth factor found in adipose tissue. This antibody is widely used in Life Sciences research to study the role of adiponectin in various physiological processes. It has been shown to be effective in detecting and quantifying adiponectin levels in samples such as serum, plasma, and cell lysates. The NUMB antibody can also be used for immunohistochemistry and Western blot analysis to visualize the expression of adiponectin in different tissues. Additionally, this antibody has been used to investigate the presence of autoantibodies against adiponectin in certain diseases, including insulin resistance and diabetes. Its high specificity and sensitivity make it a valuable tool for researchers studying adipocyte biology and related disorders.RABEP1 antibody
The RABEP1 antibody is a polyclonal antibody that has high specificity for interferon and alpha-fetoprotein. It recognizes specific glycan and fatty acid molecules and can be used in various applications in the field of Life Sciences. This monoclonal antibody exhibits high specific activity, making it a valuable tool for research purposes. It can be used to detect the presence of RABEP1 protein in samples such as human serum or cell lysates. Additionally, this antibody has been shown to have superoxide activity and may play a role in regulating lipoprotein lipase activity. With its versatility and reliability, the RABEP1 antibody is an essential component for any laboratory conducting research in these areas.PGM2L1 antibody
PGM2L1 antibody was raised using the N terminal of PGM2L1 corresponding to a region with amino acids KEDNGYKVYWETGAQITSPHDKEILKCIEECVEPWNGSWNDNLVDTSPLKBCL2 antibody
The BCL2 antibody is a highly specialized monoclonal antibody that targets the B-cell lymphoma 2 (BCL2) protein, which plays a crucial role in regulating cell survival. This antibody specifically binds to the BCL2 protein, inhibiting its function and promoting apoptosis (cell death) in cancer cells.
