Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
L1CAM antibody
The L1CAM antibody is a monoclonal antibody that is widely used in the field of Life Sciences. It specifically targets L1 cell adhesion molecule (L1CAM), which plays a crucial role in cell-to-cell interactions and neural development. This antibody has been extensively studied and validated for various applications, including immunohistochemistry and Western blotting.TIGD1 antibody
TIGD1 antibody was raised using the middle region of TIGD1 corresponding to a region with amino acids SQLMRKASPMSYFRKLPQPPQPSAATTLTSQQPSTSRQDPPPAKRVRLTEMARCKS antibody
MARCKS antibody is a neutralizing peptide agent that targets interleukin-6 (IL-6), an important cytokine involved in immune responses. It acts as an anticoagulant by inhibiting the activation of coagulation factors. The monoclonal antibody specifically binds to MARCKS, a protein involved in cell signaling and cytoskeletal regulation. By blocking the interaction between MARCKS and its binding proteins, the antibody disrupts cellular processes such as cell adhesion, migration, and proliferation. Additionally, it has been shown to inhibit the binding of fibrinogen and colony-stimulating factor (M-CSF) to their respective receptors, further modulating cellular responses. This antibody is glycosylated, meaning it has attached glycans or glycopeptides that can affect its stability and activity. Its activated form has been extensively studied for its potential therapeutic applications in autoimmune diseases and cancer.IGJ antibody
The IGJ antibody is a specific antibody that targets the immunoglobulin J (IGJ) protein. This protein is involved in the production and secretion of antibodies in the body. The IGJ antibody has been extensively studied and validated using various techniques such as transcription-polymerase chain reaction (PCR), enzyme labeling, particle chemiluminescence, and more. It has been shown to have high affinity and specificity for the IGJ protein, making it an ideal tool for research and diagnostic applications. Additionally, this monoclonal antibody has neutralizing properties, allowing it to inhibit the activity of the IGJ protein. With its low density and ability to detect IGJ in human serum at low plasma levels, this antibody is a valuable asset for any laboratory or research facility working with immunoglobulins.PRDX4 antibody
The PRDX4 antibody is a highly specific monoclonal antibody that targets and binds to peroxiredoxin-4 (PRDX4), an important antioxidant enzyme. This antibody is widely used in life sciences research to study the role of PRDX4 in various cellular processes.LOC652618 antibody
LOC652618 antibody was raised using the N terminal Of Loc652618 corresponding to a region with amino acids MAGRSGHVDVVNERRLKPLYDNLDNGNYKMALQAADKLLKKHKDLHCAKVp22 phox antibody
The p22 phox antibody is a highly reactive nuclear antibody that targets the p22 phox protein. This protein plays a crucial role in the activation of the p38 mitogen-activated protein kinase (MAPK) pathway, which is involved in various cellular processes. The p22 phox antibody is widely used in Life Sciences research to study the regulation of this pathway and its implications in different biological contexts.ID3 antibody
The ID3 antibody is a monoclonal antibody used in the field of Life Sciences. It specifically targets the ID3 receptor, which plays a crucial role in various biological processes such as collagen synthesis and receptor binding. This monoclonal antibody has been extensively studied for its potential therapeutic applications, including the treatment of autoimmune diseases and viral infections.ACAT1 antibody
ACAT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SYTRSKAAWEAGKFGNEVIPVTVTVKGQPDVVVKEDEEYKRVDFSKVPKLPPM1B antibody
PPM1B antibody is a monoclonal antibody that specifically targets the protein phosphatase 1B (PPM1B). This antibody has been shown to be activated by alpha-fetoprotein and can be used for various applications in life sciences research. PPM1B plays a crucial role in regulating cellular processes such as fatty acid metabolism, adipose tissue development, and nuclear growth factor signaling. The PPM1B antibody can be used for studying the function of PPM1B in these processes and as an inhibitor to block its activity. Additionally, this antibody can be used in antibody-drug conjugates or as a tool for detecting c-myc antigen or epidermal growth factor receptors.alpha Tubulin 4A antibody
alpha Tubulin 4A antibody was raised using the middle region of TUBA4A corresponding to a region with amino acids YAKRAFVHWYVGEGMEEGEFSEAREDMAALEKDYEEVGIDSYEDEDEGEEKLF4 antibody
KLF4 antibody was raised in mouse using recombinant human kLF4 (1-170aa) purified from E. coli as the immunogen.
CHK2 antibody
The CHK2 antibody is a potent family kinase inhibitor that is widely used in Life Sciences research. It is known for its inhibitory properties against growth factors and interferons, making it a valuable tool in studying cell signaling pathways. This antibody has cytotoxic effects on cancer cells and has been shown to inhibit the activity of phosphatases, which play a crucial role in regulating cellular processes. The CHK2 antibody is available in both polyclonal and monoclonal forms, allowing researchers to choose the best option for their specific experiments. Its inhibitory properties extend to β-catenin, a key protein involved in cell adhesion and Wnt signaling pathways. With its wide range of applications, the CHK2 antibody is an essential tool for researchers in various fields of study.ATG4A antibody
ATG4A antibody was raised using a synthetic peptide corresponding to a region with amino acids PQSLGALGGKPNNAYYFIGFLGDELIFLDPHTTQTFVDTEENGTVNDQTFMMAB antibody
The MMAB antibody is a glycoprotein that plays a crucial role in pluripotent stem cell differentiation. It acts as an activator of dopamine and acetylcholine, which are important neurotransmitters involved in various physiological processes. The MMAB antibody can be used as a serum marker to detect the presence of certain diseases and monitor their progression.NOTCH2 antibody
The NOTCH2 antibody is a highly specialized product used in the field of Life Sciences. It is an essential tool for researchers and scientists studying the NOTCH2 protein and its role in various biological processes. This antibody is designed to specifically target and neutralize the NOTCH2 protein, allowing for detailed analysis and investigation.DUT antibody
DUT antibody was raised using the N terminal of DUT corresponding to a region with amino acids AAVLSGPGPPLGRAAQHGIPRPLSSAGRLSQGCRGASTVGAAGWKGELPKBeta Lactamase antibody
Beta Lactamase antibody was raised using the middle region of LACTB corresponding to a region with amino acids QEKEGKSNEKNDFTKFKTEQENEAKCRNSKPGKKKNDFEQGELYLREKFE
ACAA2 antibody
ACAA2 antibody was raised using the N terminal of ACAA2 corresponding to a region with amino acids ALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVPPAR alpha antibody
The PPAR alpha antibody is a highly specialized product in the field of Life Sciences. This antibody is designed to target and bind to the peroxisome proliferator-activated receptor alpha (PPAR alpha), a key protein involved in various cellular processes. The antibody is produced using streptavidin-conjugated bovine γ-globulin, ensuring high specificity and sensitivity.POU2F1 antibody
The POU2F1 antibody is a highly specialized antibody that targets the POU2F1 protein. This protein plays a crucial role in various biological processes, including cell growth, differentiation, and development. The antibody specifically recognizes and binds to the POU2F1 protein, allowing for its detection and analysis in various experimental settings.
