Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PEG10 antibody
The PEG10 antibody is a highly specialized monoclonal antibody that targets and neutralizes the growth factor GM-CSF (colony-stimulating factor). This antibody has been extensively studied in the field of Life Sciences and has shown great potential for therapeutic applications. It has been found to inhibit the activity of phosphatase, which plays a crucial role in cell growth and differentiation. Additionally, the PEG10 antibody has been shown to have an impact on adipocyte function, making it a promising candidate for research in obesity and metabolic disorders. With its high specificity and affinity for its target, this antibody is a valuable tool for scientists working in various areas of biomedical research.MGC51025 antibody
MGC51025 antibody was raised using the middle region of Mgc51025 corresponding to a region with amino acids RGRAWSLLLDIDRIKSQNPGKYKVMKEKGKRSSRIIHCIQLDVSHTLQKHPLAT antibody
The PLAT antibody is a monoclonal antibody that specifically targets fibrinogen. It has been extensively studied in the field of Life Sciences and is widely used in research and diagnostic applications. This antibody has shown excellent binding affinity and specificity for fibrinogen, making it an ideal tool for various experimental techniques.Vitronectin antibody
Vitronectin antibody was raised in sheep using human Vitronectin purified from plasma as the immunogen.Keratin 15 antibody
The Keratin 15 antibody is a glycopeptide that targets the human serum androgen. It is an essential tool for researchers in the field of Life Sciences, as it plays a crucial role in various cellular processes. This antibody specifically recognizes Keratin 15, which is a protein involved in the maintenance and integrity of epithelial tissues.OSGEP antibody
OSGEP antibody was raised using the N terminal of OSGEP corresponding to a region with amino acids PPGTGFLPGDTARHHRAVILDLLQEALTESGLTSQDIDCIAYTKGPGMGAFactor VIII antibody
Factor VIII antibody was raised in mouse using human factor VIII as the immunogen.
ATIC antibody
ATIC antibody was raised using the N terminal of ATIC corresponding to a region with amino acids YVVVSTEMQSSESKDTSLETRRQLALKAFTHTAQYDEAISDYFRKQYSKGAP1G1 antibody
AP1G1 antibody was raised using the C terminal of AP1G1 corresponding to a region with amino acids DHMRSALLERMPVMEKVTTNGPTEIVQTNGETEPAPLETKPPPSGPQPTSAQP1 antibody
The AQP1 antibody is a polyclonal antibody that specifically targets Aquaporin 1, a water channel protein. It can be used in various applications such as immunocytochemical localization and western blotting. The AQP1 antibody has been shown to bind to the apical membrane of cells and is useful for studying the function and distribution of Aquaporin 1 in different tissues and cell types.PAK7 antibody
The PAK7 antibody is a highly specialized protein that plays a crucial role in various cellular processes. This monoclonal antibody has the ability to neutralize and immobilize PAK7 dimers, which are important for cell growth and survival. By targeting PAK7, this antibody can effectively inhibit its cytotoxic effects and prevent the activation of downstream signaling pathways.
SMNDC1 antibody
SMNDC1 antibody was raised using the C terminal of SMNDC1 corresponding to a region with amino acids KGQVKRSIFASPESVTGKVGVGTCGIADKPMTQYQDTSKYNVRHLMPQCopine I antibody
Copine I antibody was raised using the N terminal of CPNE1 corresponding to a region with amino acids TVQKLRFGIYDIDNKTPELRDDDFLGGAECSLGQIVSSQVLTLPLMLKPGProtein C antibody
Protein C antibody is a highly specialized antibody that targets the activated form of protein C, an important regulator of blood coagulation. This antibody specifically recognizes the active form of protein C and can be used in various research applications, particularly in the field of life sciences.
CASP3 antibody
The CASP3 antibody is a highly effective antibody that plays a crucial role in various biological processes. It is a multidrug antibody that targets superoxide and steroid molecules, making it an essential tool in the field of life sciences. This antibody specifically binds to actin filaments, which are vital for cell structure and movement.ESE1 antibody
Human ESE1 internal region immunogen; affinity purified Rabbit polyclonal ESE1 antibody
SAP155 antibody
The SAP155 antibody is a high-quality polyclonal antibody that is widely used in Life Sciences research. It specifically targets SAP155, a protein that plays a crucial role in various cellular processes such as splicing and gene regulation. This antibody is highly specific and has been extensively validated for its performance in immunohistochemistry, western blotting, and other applications.c-Kit antibody
c-Kit antibody was raised in Mouse using a purified recombinant fragment of C-kit expressed in E. coli as the immunogen.KCTD16 antibody
KCTD16 antibody was raised using the N terminal of KCTD16 corresponding to a region with amino acids KREAEYFQLPDLVKLLTPDEIKQSPDEFCHSDFEDASQGSDTRICPPSSLIL16 antibody
IL16 antibody was raised in Mouse using a purified recombinant fragment of human IL-16 expressed in E. coli as the immunogen.Thioredoxin antibody
Thioredoxin antibody is an essential component in the field of Life Sciences. It is a type of antibody that specifically targets and binds to thioredoxin, a protein involved in various cellular processes. This antibody has been extensively studied for its role in regulating glycosylation, endothelial growth, interferon signaling, enteroendocrine cell function, and caspase-9-mediated apoptosis.
