Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(739 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
Sideroflexin 1 antibody
Sideroflexin 1 antibody was raised using the N terminal of SFXN1 corresponding to a region with amino acids MSGELPPNINIKEPRWDQSTFIGRANHFFTVTDPRNILLTNEQLESARKI
Purity:Min. 95%ARF1 antibody
ARF1 antibody was raised in rabbit using the middle region of ARF1 as the immunogenPurity:Min. 95%CBFA2T2H antibody
CBFA2T2H antibody was raised in rabbit using the middle region of CBFA2T2H as the immunogenPurity:Min. 95%SLC24A4 antibody
SLC24A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids PSLEKICERLHLSEDVAGATFMAAGSSTPELFASVIGVFITHGDVGVGTIPurity:Min. 95%NR3C1 antibody
NR3C1 antibody was raised in rabbit using the N terminal of NR3C1 as the immunogenPurity:Min. 95%BCL2 antibody
The BCL2 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It is designed to target and neutralize the BCL2 protein, which plays a crucial role in regulating cell survival and apoptosis. By binding to BCL2, this antibody effectively inhibits its function and prevents abnormal cell growth and proliferation.Purity:Min. 95%NEURL2 antibody
NEURL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MAAASEPVDSGALWGLERPEPPPTRFHRVHGANIRVDPSGTRATRVESFA
Purity:Min. 95%AGK antibody
AGK antibody was raised in rabbit using the N terminal of AGK as the immunogenPurity:Min. 95%HAS3 antibody
HAS3 antibody was raised using the N terminal of HAS3 corresponding to a region with amino acids GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDPurity:Min. 95%Dcdc2a antibody
Dcdc2a antibody was raised in rabbit using the N terminal of Dcdc2a as the immunogenPurity:Min. 95%OR13C5 antibody
OR13C5 antibody was raised in rabbit using the N terminal of OR13C5 as the immunogenPurity:Min. 95%SDCBP antibody
SDCBP antibody was raised using a synthetic peptide corresponding to a region with amino acids NGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVPurity:Min. 95%STYK1 antibody
STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKIPurity:Min. 95%ARMCX3 antibody
ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKEPurity:Min. 95%CDC4 (69kDa) antibody
CDC4 (69kDa) antibody was raised in rabbit using N terminus of the 69 kDa isoform of the hCdc4 protein as the immunogen.Purity:Min. 95%PCDH12 antibody
PCDH12 antibody was raised using the middle region of PCDH12 corresponding to a region with amino acids SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVTPurity:Min. 95%Junctophilin 1 antibody
Junctophilin 1 antibody was raised using the C terminal of JPH1 corresponding to a region with amino acids SNGELHSQYHGYYVKLNAPQHPPVDVEDGDGSSQSSSALVHKPSANKWSPPurity:Min. 95%AADACL4 antibody
AADACL4 antibody was raised using the N terminal of AADACL4 corresponding to a region with amino acids FIRFLHDSVRIKKDPELVVTDLRFGTIPVRLFQPKAASSRPRRGIIFYHGPurity:Min. 95%PRELP antibody
PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSHPurity:Min. 95%DNASE2B antibody
DNASE2B antibody was raised using the middle region of DNASE2B corresponding to a region with amino acids IKAIKLSRHSYFSSYQDHAKWCISQKGTKNRWTCIGDLNRSPHQAFRSGG
Purity:Min. 95%SMYD1 antibody
SMYD1 antibody was raised in rabbit using the N terminal of SMYD1 as the immunogenPurity:Min. 95%AK3 antibody
AK3 antibody was raised using the N terminal of AK3 corresponding to a region with amino acids MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGT
Purity:Min. 95%NLK antibody
NLK antibody was raised in rabbit using the middle region of NLK as the immunogenPurity:Min. 95%DLG3 antibody
DLG3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HEQAAAALKRAGQSVTIVAQYRPEEYSRFESKIHDLREQMMNSSMSSGSGPurity:Min. 95%SLC6A3 antibody
SLC6A3 antibody was raised in rabbit using the N terminal of SLC6A3 as the immunogenPurity:Min. 95%BCL10 antibody
BCL10 antibody was raised in rabbit using C terminal sequence [EMFLPLRSRTVSRQC] of Bcl10 as the immunogen.
Purity:Min. 95%MIP1 alpha antibody
MIP1 alpha antibody was raised in rabbit using highly pure recombinant rat MIP1 alpha as the immunogen.
Purity:Min. 95%FGFR1 antibody
The FGFR1 antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and inhibits the growth factor receptor FGFR1, which plays a crucial role in cell growth and proliferation. By blocking the activation of FGFR1, this antibody prevents the downstream signaling pathways that promote cell division.
Purity:Min. 95%Dopamine D3 Receptor antibody
Dopamine D3 receptor antibody was raised in rabbit using a 19 amino acid peptide of human D3R as the immunogen.Purity:Min. 95%ALDH6A1 antibody
ALDH6A1 antibody was raised using the middle region of ALDH6A1 corresponding to a region with amino acids AVLVGEAKKWLPELVEHAKNLRVNAGDQPGADLGPLITPQAKERVCNLIDPurity:Min. 95%TMEFF1 antibody
TMEFF1 antibody was raised using the middle region of TMEFF1 corresponding to a region with amino acids YSDNGSGSGEGEEEGSGAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDPurity:Min. 95%SMC4 antibody
SMC4 antibody was raised using the N terminal of SMC4 corresponding to a region with amino acids SGRTESPATAAETASEELDNRSLEEILNSIPPPPPPAMTNEAGAPRLMITPurity:Min. 95%WT1 antibody
WT1 antibody was raised in rabbit using the N terminal of WT1 as the immunogen
Purity:Min. 95%TMED10 antibody
TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF
Purity:Min. 95%GLMN antibody
GLMN antibody was raised using the middle region of GLMN corresponding to a region with amino acids LKRTRNNKWFTGPQLISLLDLVLFLPEGAETDLLQNSDRIMASLNLLRYLPurity:Min. 95%CLTA antibody
CLTA antibody was raised in rabbit using the C terminal of CLTA as the immunogenPurity:Min. 95%HFE antibody
HFE antibody was raised using the N terminal of HFE corresponding to a region with amino acids MGASEQDLGLSLFEALGYVDDQLFVFYDHESRRVEPRTPWVSSRISSQMWPurity:Min. 95%ZNF284 antibody
ZNF284 antibody was raised in rabbit using the middle region of ZNF284 as the immunogenPurity:Min. 95%GABABR1 antibody
GABABR1 antibody was raised in rabbit using residues 33-54 [PHLPRPHPRVPPHPSSERRAVY] of the GABABR1 subunit as the immunogen.Purity:Min. 95%Pdyn antibody
Pdyn antibody was raised in rabbit using the middle region of Pdyn as the immunogenPurity:Min. 95%STX4 antibody
STX4 antibody was raised in rabbit using the C terminal of STX4 as the immunogenPurity:Min. 95%PRDM6 antibody
PRDM6 antibody was raised in rabbit using the N terminal of PRDM6 as the immunogenPurity:Min. 95%LOC91664 antibody
LOC91664 antibody was raised in rabbit using the middle region of LOC91664 as the immunogen
Purity:Min. 95%CRYBA4 antibody
CRYBA4 antibody was raised in rabbit using the middle region of CRYBA4 as the immunogenPurity:Min. 95%PSDR1 antibody
PSDR1 antibody was raised in rabbit using N terminal sequence MVELMFP and C terminal sequence LLGLPID of the human PSDR1 protein as the immunogen.Purity:Min. 95%SPP1 antibody
SPP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRIAVICFCLLGITCAIPVKQADSGSSEEKQLYNKYPDAVATWLNPDPSQPurity:Min. 95%
