Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75447 products of "Primary Antibodies"
Macrophage Scavenger Receptor antibody
Macrophage scavenger receptor antibody was raised in rat using Raw 264 cell line as the immunogen.IFN γ antibody (biotin)
IFN gamma antibody (biotin) was raised in mouse using human IFN-gamma as the immunogen.ATIC antibody
ATIC antibody was raised using the middle region of ATIC corresponding to a region with amino acids RTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTMAGEL2 antibody
MAGEL2 antibody was raised in rabbit using the C terminal of MAGEL2 as the immunogenPurity:Min. 95%Protein S antibody (HRP)
Protein S antibody (HRP) was raised in goat using human Protein S purified from plasma as the immunogen.RHOB antibody
RHOB antibody was raised using the middle region of RHOB corresponding to a region with amino acids CPNVPIILVANKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAYDYDonkey anti Mouse IgG (H + L) (rhodamine)
Donkey anti-mouse IgG (H + L) (rhodamine) was raised in donkey using murine IgG (H&L) as the immunogen.NET1 antibody
NET1 antibody was raised using the N terminal of NET1 corresponding to a region with amino acids RGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRKCNN1 antibody
KCNN1 antibody was raised using the C terminal of KCNN1 corresponding to a region with amino acids KIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEARLATLESRLD
hnRNPF antibody
The hnRNPF antibody is a polyclonal antibody that is used in various diagnostic applications. It is highly reactive and can be used to detect the presence of hnRNPF, a serine protease, in biological samples. This antibody has neutralizing properties and can be used to inhibit the activity of hnRNPF in experimental settings. It is commonly used as a diagnostic reagent in research laboratories and clinical settings.cSRC antibody
The cSRC antibody is a highly specialized Polyclonal Antibody used in Life Sciences research. This antibody specifically targets the activated form of the cSRC protein, which plays a crucial role in cell signaling and regulation.
ARHGAP15 antibody
ARHGAP15 antibody was raised using the middle region of ARHGAP15 corresponding to a region with amino acids VKSRLKKFITRRPSLKTLQEKGLIKDQIFGSHLHKVCERENSTVPWFVKQBBS4 antibody
BBS4 antibody was raised using the N terminal of BBS4 corresponding to a region with amino acids YVQALIFRLEGNIQESLELFQTCAVLSPQSADNLKQVARSLFLLGKHKAAPDP2 antibody
PDP2 antibody was raised using the middle region of PDP2 corresponding to a region with amino acids LQRSILERGFNTEALNIYQFTPPHYYTPPYLTAEPEVTYHRLRPQDKFLVPR8 antibody
The PR8 antibody is a highly specialized collagen antibody that targets specific proteins in the body. It has been extensively studied and proven to inhibit the activity of protein kinases, which play a crucial role in various cellular processes. This antibody has also been shown to effectively block the interaction between peptide mimics and microvessel endothelial cells, preventing the formation of abnormal blood vessels.Influenza B antibody (biotin)
Influenza B antibody (biotin) was raised in goat using the yamagata strain of influenza B as the immunogen.
MSI2 antibody
MSI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LRDYFSKFGEIRECMVMRDPTTKRSRGFGFVTFADPASVDKVLGQPHHELp53 antibody
The p53 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences for various applications. This antibody is specifically designed to bind to the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. By targeting this protein, the p53 antibody can be used to study its activation status and evaluate its potential as a therapeutic target.
ACCN1 antibody
ACCN1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GDIGGQMGLFIGASILTILELFDYIYELIKEKLLDLLGKEEDEGSHDENV
