Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75447 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
SERPINB2 antibody
The SERPINB2 antibody is a monoclonal antibody that is used in mass spectrometric methods to detect and study inhibitors of serine proteases. It specifically targets SERPINB2, a protein complex involved in regulating the activity of serine proteases. This antibody can be used in various life sciences research applications, including the study of nuclear extracts and the detection of autoantibodies. Additionally, it has been shown to inhibit the growth factor signaling pathway and act as a kinase inhibitor. The SERPINB2 antibody is a valuable tool for researchers in the field of protein analysis and characterization.BAFF antibody
BAFF antibody was raised in mouse using highly pure recombinant human BAFF as the immunogen.Borrelia burgdorferi Ab
Borrelia burgdorferi Ab is an amide that acts as a chemokine in the human body. It has been extensively studied in Life Sciences for its role in various processes. This compound has shown to be nephrotoxic and can be detected in human serum using Monoclonal Antibodies. Borrelia burgdorferi Ab has also been associated with the production of autoantibodies and the regulation of TGF-beta. Furthermore, it has shown cytotoxic effects on certain cells and has been studied for its potential therapeutic applications. The use of monoclonal antibodies targeting Borrelia burgdorferi Ab has shown promising results in research studies, indicating its potential as a diagnostic tool or therapeutic agent.RSV Antibody
The RSV Antibody is a highly effective antiviral treatment that utilizes monoclonal antibodies to combat respiratory syncytial virus (RSV) infections. These antibodies specifically target and neutralize the virus, preventing it from infecting healthy cells and spreading throughout the body.MDM4 antibody
The MDM4 antibody is a highly specialized monoclonal antibody that targets the growth factor MDM4. This antibody has been shown to be effective in inhibiting the activity of MDM4, which plays a crucial role in adipose tissue development. By binding to MDM4, the antibody prevents its activation and subsequent signaling pathways involved in adipogenesis. Additionally, this monoclonal antibody has been found to interact with histidine residues on MDM4, further enhancing its neutralizing effect.
RBP4 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. This medication is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. It works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Studies have shown its high efficacy through patch-clamp techniques on human erythrocytes. The drug undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits their cell growth in culture.E2F1 antibody
The E2F1 antibody is a highly specialized growth factor that plays a crucial role in various cellular processes. It is an essential component of the cell cycle regulation and is involved in the transcriptional activation of genes required for DNA replication and cell division. This monoclonal antibody specifically targets E2F1, allowing for precise detection and analysis of its expression levels.Galectin 9 antibody
Galectin 9 antibody is a glycoprotein that belongs to the class of polyclonal antibodies. It is highly reactive and activated in various life science applications. This antibody acts as a growth factor and exhibits antiviral properties by binding to specific proteins. Galectin 9 antibody has been shown to have neutralizing and cytotoxic effects on HL-60 cells, making it a potent tool for research purposes. Its multidrug resistance capabilities make it an ideal candidate for developing therapeutic antibodies. With its high specificity and functionality, this monoclonal antibody is a valuable asset in the field of biotechnology and immunology.Troponin I Type 3 antibody
Troponin I Type 3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RVRISADAMMQALLGARAKESLDLRAHLKQVKKEDTEKENREVGDWRKNI
BXDC5 antibody
BXDC5 antibody was raised using the N terminal of BXDC5 corresponding to a region with amino acids AAAFPPGFSISEIKNKQRRHLMFTRWKQQQRKEKLAAKKKLKKEREALGDSAMHD1 antibody
The SAMHD1 antibody is a highly effective monoclonal antibody that targets and neutralizes the SAMHD1 protein. This antibody has been shown to induce lysis of cells expressing high levels of SAMHD1, making it an essential tool for research in the field of Life Sciences. Additionally, the SAMHD1 antibody has demonstrated its efficacy in blocking the activity of vasoactive intestinal peptide (VIP), a potent vasodilator. This makes it a valuable tool for studying the role of VIP in various physiological processes. Furthermore, this antibody can be used in combination with chimeric receptors to enhance the cytotoxic effects of targeted therapies. With its wide range of applications and exceptional specificity, the SAMHD1 antibody is an invaluable asset for researchers in need of reliable tools for their studies.Annexin A13 antibody
Annexin A13 antibody was raised using the N terminal of ANXA13 corresponding to a region with amino acids KKLNKACKGMGTNEAAIIEILSGRTSDERQQIKQKYKATYGKELEEVLKSDDX19A antibody
DDX19A antibody was raised using a synthetic peptide corresponding to a region with amino acids IKEEKVKADTNGIIKTSTTAEKTDEEEKEDRAAQSLLNKLIRSNLVDNTNClaudin 15 antibody
Claudin 15 antibody was raised using the C terminal of CLDN15 corresponding to a region with amino acids LCSACCCGSDEDPAASARRPYQAPVSVMPVATSDQEGDSSFGKYGRNAYV
KI67 antibody
KI67 antibody was raised in Mouse using synthetic peptide corresponding to aa (CEDLAGFKELFQTPG) of human KI67, conjugated to KLH as the immunogen.Borrelia burgdorferi antibody (biotin)
Borrelia burgdorferi antibody (biotin) was raised in rabbit using a whole cell preparation from Borrelia burgdorferi as the immunogen.Ret antibody
The Ret antibody is a highly specialized product in the field of Life Sciences. It is a polyclonal antibody that specifically targets the Ret protein, which plays a crucial role in various biological processes. This antibody has been extensively studied and proven to be effective in neutralizing the activity of Ret.
EIF4A1 antibody
EIF4A1 antibody was raised using the middle region of EIF4A1 corresponding to a region with amino acids TMPSDVLEVTKKFMRDPIRILVKKEELTLEGIRQFYINVEREEWKLDTLCABHD5 antibody
ABHD5 antibody was raised using the C terminal of ABHD5 corresponding to a region with amino acids SVIFGARSCIDGNSGTSIQSLRPHSYVKTIAILGAGHYVYADQPEEFNQK
