Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Found 75448 products of "Primary Antibodies"
EIF4B antibody
EIF4B antibody was raised using the C terminal of EIF4B corresponding to a region with amino acids NPPARSQSSDTEQQSPTSGGGKVAPAQPSEEGPGRKDENKVDGMNAPKGQAmphetamine antibody
Amphetamine antibody was raised in mouse using amphetamine-BSA as the immunogen.NR2F1 antibody
NR2F1 antibody was raised using the N terminal of NR2F1 corresponding to a region with amino acids GEQQQQAGSGAPHTPQTPGQPGAPATPGTAGDKGQGPPGSGQSQQHIECVCPSF3 antibody
CPSF3 antibody was raised using the N terminal of CPSF3 corresponding to a region with amino acids MAAEIPNIKPDILIIESTYGTHIHEKREEREARFCNTVHDIVNRGGRGLIMYL6 antibody
MYL6 antibody was raised using the N terminal of MYL6 corresponding to a region with amino acids CDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVSOX6 antibody
The SOX6 antibody is a highly specific monoclonal antibody that is used in Life Sciences research. It is designed to target the nuclear protein SOX6, which plays a crucial role in various cellular processes. This antibody has been extensively validated using mass spectrometric methods and other techniques to ensure its specificity and reliability.
KLHDC8A antibody
KLHDC8A antibody was raised using the middle region of KLHDC8A corresponding to a region with amino acids NQPTVLETAEAFHPGKNKWEILPAMPTPRCACSSIVVKNCLLAVGGVNQGSMA antibody
The SMA antibody is a monoclonal antibody that specifically targets alpha-fetoprotein (AFP). It is activated to bind with high affinity to AFP, making it a valuable tool in various research and diagnostic applications. This antibody has been used in studies related to heparin-induced thrombocytopenia (HIT), where it has shown promising results in detecting HIT antibodies. Furthermore, the SMA antibody has also been utilized in research on β-catenin and epidermal growth factor (EGF) signaling pathways. It has been shown to inhibit the activity of β-catenin and block EGF-induced cell proliferation. Additionally, this antibody has been used in studies related to antiphospholipid antibodies and interferon signaling pathways. Its high specificity and affinity make it an essential tool for researchers in the field of Life Sciences.GNMT antibody
The GNMT antibody is a monoclonal antibody that targets the enzyme glycine N-methyltransferase (GNMT). It has been shown to have various therapeutic applications, including the treatment of thrombocytopenia and certain types of cancer. The GNMT antibody specifically binds to GNMT and inhibits its activity, which can lead to the suppression of tumor growth and metastasis. Additionally, this antibody has shown potential in modulating the immune response by interfering with interferon signaling pathways and enhancing the cytotoxic effects of other immune cells. With its specificity and versatility, the GNMT antibody holds promise in the field of life sciences for both research and clinical applications.
HDAC3 antibody
The HDAC3 antibody is a highly specific monoclonal antibody that has cytotoxic properties. It is commonly used in the field of Life Sciences for various applications. This antibody binds to HDAC3, which is an enzyme involved in the regulation of gene expression through histone deacetylation. By targeting HDAC3, this antibody can disrupt its function and potentially inhibit cell growth.IFNGR antibody
The IFNGR antibody is a highly specific polyclonal antibody that targets the interferon gamma receptor (IFNGR). It is widely used in life sciences research to study the role of IFNGR in various cellular processes. This antibody exhibits high affinity and specificity for IFNGR, making it an excellent tool for detecting and quantifying IFNGR expression levels in different cell types.
PBR antibody
The PBR antibody is a highly specialized monoclonal antibody that targets the subtilisin/kexin type of activated antibodies. It is specifically designed to neutralize the hepatocyte growth factor and reactive growth factor in order to inhibit their cytotoxic effects. This antibody has been shown to effectively bind to angptl3, a protein involved in the regulation of mesenchymal stem cells. The PBR antibody is widely used in Life Sciences research for its ability to immobilize and bind proteins, making it an essential tool for studying various cellular processes. Additionally, polyclonal antibodies are also available for those looking for broader reactivity and versatility in their experiments.
PSMG1 antibody
PSMG1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPNIVHDAPE1 antibody
The APE1 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets and binds to beta amyloid, a protein associated with various neurological disorders such as Alzheimer's disease. This antibody has also shown promising results in detecting alpha-fetoprotein, a marker for certain types of cancer.Troponin I antibody (Cardiac)
Troponin I antibody (cardiac) was raised in mouse using amino acid residues 23-29 of cTnI as the immunogen.TRP2 antibody
TRP2 antibody is a specific antibody that targets the extracellular antigen TRP2. It is commonly used as a serum marker in various medical applications, including cancer research and diagnostics. TRP2 antibody plays a crucial role in detecting the presence of TRP2, which is often associated with certain types of cancers. This antibody has been extensively studied and has shown promising results in identifying and monitoring the progression of diseases. Whether you are working in life sciences or conducting cutting-edge research, TRP2 antibody is an invaluable tool for detecting and analyzing this important biomarker. With its high specificity and sensitivity, this polyclonal antibody can provide accurate and reliable results for your experiments. Trust TRP2 antibody to deliver precise and consistent data that will contribute to advancing medical knowledge and improving patient care.CHK1 antibody
CHK1 antibody was raised in Mouse using a purified recombinant fragment of CHK1 expressed in E. coli as the immunogen.PRKACA antibody
PRKACA antibody was raised using the N terminal of PRKACA corresponding to a region with amino acids MASNSSDVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVCD27 antibody
The CD27 antibody is a monoclonal antibody that specifically targets the CD27 molecule, a protein found on the surface of certain cells. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.TNFR2 antibody
The TNFR2 antibody is a highly specific antibody that targets a low pH target molecule. It belongs to the group of Polyclonal Antibodies and is widely used in the field of Life Sciences. This antibody can be used for various applications, including flow immunoassays and ultrasensitive detection.SERCA2 antibody
The SERCA2 antibody is a monoclonal antibody that has cytotoxic effects and induces necrosis in targeted cells. It specifically targets the telomerase enzyme, which plays a crucial role in cell division and growth. The antibody has been shown to inhibit telomerase activity, leading to cell death through apoptosis. Additionally, this antibody has been found to have autoantibody properties, meaning it can target and attack healthy cells in the body. It can also bind to colloidal particles and interfere with their function. Furthermore, the SERCA2 antibody acts as a CXCR4 family kinase inhibitor, blocking the signaling pathway of chemokines. This inhibition reduces the production of superoxide, a highly reactive molecule involved in oxidative stress. In Life Sciences research, this antibody is commonly used to study growth factors such as hepatocyte growth factor and their effects on cellular processes. However, caution should be exercised when using this antibody as it may have nephrotoxic effects on kidney cells.
