Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,620 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(751 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,551 products)
- Metabolism Antibodies(279 products)
- Microbiology Antibodies(740 products)
- Signal Transduction(2,717 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75448 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
FBXW11 antibody
FBXW11 antibody was raised using the N terminal of FBXW11 corresponding to a region with amino acids CLQSMPSVRCLQISNGTSSVIVSRKRPSEGNYQKEKDLCIKYFDQWSESDSLC27A4 antibody
SLC27A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKLPurity:Min. 95%CPEB4 antibody
CPEB4 antibody was raised using the N terminal of CPEB4 corresponding to a region with amino acids DEILGSEKAKSQQQEQQDPLEKQQLSPSPGQEAGILPETEKAKSEENQGDSF3B14 antibody
SF3B14 antibody was raised using the middle region of SF3B14 corresponding to a region with amino acids HLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPKAATF antibody
The AATF antibody is a monoclonal antibody that targets the AATF protein. It has been shown to be effective in inhibiting the growth of cancer cells, particularly in breast cancer (MCF-7) cells. The AATF antibody works by blocking the interaction between AATF and other proteins involved in cell proliferation and survival, such as adalimumab and interleukin-6. This inhibition leads to a decrease in tumor necrosis factor-alpha (TNF-α) production and ultimately hinders cancer cell growth.MMP15 antibody
The MMP15 antibody is a powerful tool used in Life Sciences research. It specifically targets and neutralizes the activity of matrix metalloproteinase 15 (MMP15), an enzyme involved in various biological processes such as tissue remodeling, wound healing, and cancer progression.GLCCI1 antibody
GLCCI1 antibody was raised using the middle region of GLCCI1 corresponding to a region with amino acids PYLTGQWPRDPHVHYPSCMKDKATQTPSCWAEEGAEKRSHQRSASWGSADPRKRA antibody
PRKRA antibody was raised in mouse using recombinant Human Protein Kinase, Interferon-Inducible Double Stranded Rna Dependent ActivatorGABRR1 antibody
GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVHPurity:Min. 95%SETD7 antibody
The SETD7 antibody is a monoclonal antibody that specifically targets SETD7, an enzyme involved in various cellular processes. This antibody has been shown to react with levothyroxine and interleukin-6, indicating its potential role in modulating thyroid hormone levels and immune responses. Additionally, the SETD7 antibody has demonstrated reactivity towards basic proteins such as collagen, suggesting its involvement in extracellular matrix remodeling. Furthermore, this monoclonal antibody may have implications in cholinergic signaling due to its reactivity with acetylcholine and acetyltransferase. Overall, the SETD7 antibody shows promise as a versatile tool for studying protein function and exploring potential therapeutic applications.TP53 antibody
The TP53 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the TP53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The TP53 antibody binds to the collagen and actin filaments within cells, allowing for the detection and study of TP53 expression levels.GPR18 antibody
The GPR18 antibody is a monoclonal antibody that specifically targets the G protein-coupled receptor 18 (GPR18). This receptor is located on the apical membrane of various cell types, including functional endothelial cells. The GPR18 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various applications.CCL5 antibody
The CCL5 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed for neutralizing the activity of CCL5, a chemokine involved in various cellular processes such as inflammation and immune response. This antibody binds to the CCL5 antigen, blocking its interaction with receptors and preventing downstream signaling events.AFP antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug from the class of rifamycins. It is specifically designed to combat tuberculosis infections by targeting active compounds and exhibiting strong bactericidal activity. Through its unique mechanism of action, this drug binds to DNA-dependent RNA polymerase, preventing transcription and replication of bacteria. Its effectiveness has been demonstrated in various studies using advanced techniques like transcription-quantitative polymerase chain and patch-clamp technique.C1ORF103 antibody
C1ORF103 antibody was raised using the middle region of C1Orf103 corresponding to a region with amino acids SHSKTRQEKRTEMEYYTHEKQEKGTLNSNAAYEQSHFFNKNYTEDIFPVTWDR34 antibody
WDR34 antibody was raised using the C terminal of WDR34 corresponding to a region with amino acids SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES
KCTD21 antibody
KCTD21 antibody was raised using the middle region of KCTD21 corresponding to a region with amino acids VFNANIFSTSCLFLKLLGSKLFYCSNGNLSSITSHLQDPNHLTLDWVANVMMP19 antibody
The MMP19 antibody is a monoclonal antibody that specifically targets the matrix metalloproteinase 19 (MMP19). This glycoprotein plays a crucial role in various biological processes, including tissue remodeling and wound healing. The MMP19 antibody is widely used in Life Sciences research to study the function and regulation of MMP19.ING3 antibody
ING3 antibody was raised using the N terminal of ING3 corresponding to a region with amino acids MDQLEQRVSEFFMNAKKNKPEWREEQMASIKKDYYKALEDADEKVQLANQ
CD23 Antibody
The CD23 Antibody is a monoclonal antibody that targets the IL-2 receptor, specifically the low-affinity receptor. This antibody has been extensively studied in in-vitro culture and Life Sciences research. It has been shown to have various biological activities, including growth factor activity and antioxidant activity. The CD23 Antibody binds to the CD23 receptor molecule, which is expressed on various cell types, such as granulosa cells. This antibody can be used in experiments involving transcription-polymerase chain reaction (PCR) or immunohistochemistry. It is an essential tool for researchers working with Monoclonal Antibodies and studying various biological processes.
