Primary Antibodies

XYLT2 antibody was raised using the middle region of XYLT2 corresponding to a region with amino acids PMGTPLCRFEPRGLPSSVHLYFYDDHFQGYLVTQAVQPSAQGPAETLEMW

B3gat2 antibody was raised in rabbit using the C terminal of B3gat2 as the immunogen

PIGT antibody was raised using the N terminal of PIGT corresponding to a region with amino acids PLPSGDVAATFQFRTRWDSELQREGVSHYRLFPKALGQLISKYSLRELHL

Atp10d antibody was raised in rabbit using the middle region of Atp10d as the immunogen

CD105 antibody (biotin) was raised in mouse using membrane preparation of human B-linage leukemia cells as the immunogen.

E. coli O157 antibody (FITC) was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.

SLC39A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids ASLVSLELGLLLAVLVVTATASPPAGLLSLLTSGQGALDQEALGGLLNTL

CD45.2 antibody (PE) was raised in mouse using CD45.2 as the immunogen.

The Listeria antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It acts as a growth factor and has been extensively studied for its potential applications in various research areas. This antibody specifically targets Listeria, a bacterium known to cause foodborne illnesses.

TRIM27 antibody was raised in rabbit using the middle region of TRIM27 as the immunogen

Zfp275 antibody was raised in rabbit using the middle region of Zfp275 as the immunogen

GCP2 antibody was raised in rabbit using highly pure recombinant human GCP-2 as the immunogen.

CD45R antibody (biotin) was raised in rat using abelson murine leukemia virus-induced pre-B tumor cells as the immunogen.

CD25 antibody (biotin) was raised in rat using IL-2-dependent BALB/c mouse helper T-cell clone HT-2 as the immunogen.

BMP6 antibody was raised in rabbit using the N terminal of BMP6 as the immunogen

BBS2 antibody was raised in rabbit using the N terminal of BBS2 as the immunogen

PIMT antibody was raised in rabbit using residues 839-853 of the C terminus of the PIMT protein as the immunogen.

CD3e antibody (CY5) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.

DCP1B antibody was raised in rabbit using the N terminal of DCP1B as the immunogen

ARL6IP2 antibody was raised using the C terminal of ARL6IP2 corresponding to a region with amino acids MEQVCGGDKPYIAPSDLERKHLDLKEVAIKQFRSVKKMGGDEFCRRYQDQ

CD16 antibody (PE) was raised in mouse using human polymorphonuclear leukocytes as the immunogen.

PIGK antibody was raised using the N terminal of PIGK corresponding to a region with amino acids MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLV

ZNF431 antibody was raised in rabbit using the middle region of ZNF431 as the immunogen

CD3e antibody (Allophycocyanin) was raised in hamster using T cell receptor complexes derived from C6VL-BS thymoma cells as the immunogen.

CD163 antibody (biotin) was raised in mouse using human monocytes as the immunogen.

SLC20A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LVALYLVYDTGDVSSKVATPIWLLLYGGVGICVGLWVWGRRVIQTMGKDL

LAMP1 antibody was raised in rabbit using the N terminal of LAMP1 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is specifically designed to target and treat tuberculosis infections by effectively inhibiting bacterial growth. By binding to DNA-dependent RNA polymerase, it prevents transcription and replication, making it a bactericidal agent. The effectiveness of this drug has been demonstrated through extensive research using advanced techniques such as the patch-clamp technique on human erythrocytes. It undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it binds specifically to markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their growth in culture.

CD106 antibody (Azide free) was raised in rat using murine CD106/VCAM-1 as the immunogen.

Ctsd antibody was raised in rabbit using the C terminal of Ctsd as the immunogen

BVES antibody was raised using the middle region of BVES corresponding to a region with amino acids  YLIGKDITNKLYSLNDPTLNDKKAKKLEHQLSLCTQISMLEMRNSIASSS

Anti-Human TIGIT Monoclonal Antibody

CD11b antibody (biotin) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

DNAI2 antibody was raised in rabbit using the N terminal of DNAI2 as the immunogen

CD30 antibody (PE) was raised in hamster using recombinant murine CD30 extracellular domain-mouse IgG1 fusion protein as the immunogen.

Midkine antibody was raised in rabbit using highly pure recombinant human Midkine as the immunogen.

Purified Polyclonal ANKRD1 antibody

Pex2 antibody was raised in rabbit using the C terminal of Pex2 as the immunogen

SLC27A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids YKFQKTELRKEGFDPAIVKDPLFYLDAQKGRYVPLDQEAYSRIQAGEEKL

CD20 antibody (PE-CY7) was raised in mouse using human CD20 as the immunogen.

CD45RB antibody (Spectral Red) was raised in rat using cloned murine Th2 cell lines as the immunogen.

GABRR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MLAVPNMRFGIFLLWWGWVLATESRMHWPGREVHEMSKKGRPQRQRREVH

Purified Polyclonal MOV10L1 antibody

Rabbit polyclonal Fibronectin antibody (Prediluted for IHC)

CD3 antibody (PE-CY7) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.