Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PTH antibody
The PTH antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and inhibit the action of parathyroid hormone (PTH), a hormone peptide involved in regulating calcium and phosphate levels in the body. This monoclonal antibody can be used as a powerful tool for studying the role of PTH in various biological processes.
MYST1 antibody
MYST1 antibody was raised using the N terminal of MYST1 corresponding to a region with amino acids MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGE
SHMT1 antibody
SHMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids NIIKKESNRQRVGLELIASENFASRAVLEALGSCLNNKYSEGYPGQRYYGACLY antibody
The ACLY antibody is a monoclonal antibody that specifically targets and inhibits the activity of ACLY (ATP citrate lyase), an enzyme involved in fatty acid synthesis. This antibody has been shown to reduce the viscosity of monoclonal antibodies, making it a valuable tool for improving the formulation and stability of therapeutic antibodies. In addition to its role in fatty acid synthesis, ACLY has also been implicated in various cellular processes, including epidermal growth factor signaling, chemokine production, and interleukin-6 expression. By targeting ACLY with this specific antibody, researchers can gain insights into its function and potential as a therapeutic target. The ACLY antibody is highly specific and exhibits low cross-reactivity with other proteins, making it an ideal choice for research applications.KNG1 antibody
KNG1 antibody was raised using the middle region of KNG1 corresponding to a region with amino acids YPGKDFVQPPTKICVGCPRDIPTNSPELEETLTHTITKLNAENNATFYFKGFP antibody
GFP antibody was raised in mouse using a GFP fusion protein corresponding to the full length amino acid sequence (246aa) derived from the jellyfish Aequorea victoria as the immunogen.HAT antibody
The HAT antibody is a monoclonal antibody used in Life Sciences research. It is specifically designed to target and bind to collagen, a protein found in connective tissues. The HAT antibody can be used in various applications, including immunoassays and cytotoxicity studies. It has been shown to have neutralizing properties against trypsin-like protease, which plays a role in tissue lysis. Additionally, the HAT antibody has been found to inhibit reactive oxygen species production and lipid peroxidation, making it useful for studying oxidative stress-related processes. With its high specificity and affinity for collagen, this antibody is a valuable tool for researchers working in the field of cell biology and molecular biology.
USP7 antibody
The USP7 antibody is a monoclonal antibody that targets the USP7 protein. It has been shown to have a wide range of applications in the field of Life Sciences. This antibody specifically binds to USP7 and inhibits its activity, which plays a crucial role in various cellular processes including IFN-gamma signaling, fatty acid metabolism, siderophore production, and superoxide regulation.TRIM2 antibody
The TRIM2 antibody is a highly specialized monoclonal antibody that targets insulin and has neutralizing properties. It specifically binds to cholinergic receptors, inhibiting their activity and preventing the release of insulin. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.BRS3 antibody
The BRS3 antibody is a polyclonal antibody that serves as an affinity ligand for extracellular substances. It is commonly used in the field of medicine to isolate retinal autoantibodies. The BRS3 antibody has been found to be effective in inhibiting DNA double-strand break repair and can be used as a tool for studying the mechanisms involved in this process. In addition, it has been shown to inhibit the growth of pluripotent stem cells and can be used in research related to their differentiation. The BRS3 antibody is often employed in immunohistochemical studies to detect the presence of certain markers or proteins in tissue samples. Its use in life sciences research has provided valuable insights into various biological processes and pathways.UBE2L6 antibody
UBE2L6 antibody was raised in mouse using recombinant human UBE2L6 (1-152aa) purified from E. coli as the immunogen.
VEGFR3 antibody
The VEGFR3 antibody is a highly effective medicament that targets the glucan synthase and growth factor. It belongs to the class of Monoclonal Antibodies, which are known for their specificity and potency. This antibody specifically binds to epidermal growth factor (EGF) receptors on the apical membrane of cells, inhibiting their activation. By blocking the activity of EGF receptors, this monoclonal antibody prevents the binding of other cell antibodies and autoantibodies, thereby reducing inflammation and promoting healing. Additionally, studies have shown that the VEGFR3 antibody has antiviral properties and can help alleviate hepatic steatosis. With its wide range of applications in various pharmaceutical preparations, this antibody is an essential tool in modern medicine.BTAF1 antibody
BTAF1 antibody was raised in mouse using recombinant Btaf1 Rna Polymerase Ii, B-Tfiid Transcription Factor-Associated, 170Kda (Mot1 Homolog, S. Cerevisiae) (Btaf1)Caveolin 1 antibody
The Caveolin 1 antibody is a highly effective and versatile tool used in various fields of life sciences. It is available as both polyclonal and monoclonal antibodies, allowing researchers to choose the most suitable option for their specific needs.Cdc2 antibody
Cdc2 antibody was raised in Mouse using a purified recombinant fragment of Cdc2 expressed in E. coli as the immunogen.BRAF antibody
The BRAF antibody is a powerful tool used in Life Sciences research for the detection and analysis of specific proteins. This monoclonal antibody specifically targets the BRAF protein, which plays a crucial role in cell signaling pathways and is frequently mutated in various cancers. By binding to BRAF, this antibody allows researchers to study its expression, localization, and interactions with other molecules.PIP4K2A antibody
PIP4K2A antibody was raised using the middle region of PIP4K2A corresponding to a region with amino acids EQEEVECEENDGEEEGESDGTHPVGTPPDSPGNTLNSSPPLAPGEFDPNIDPPA2 antibody
The DPPA2 antibody is a monoclonal antibody that targets and neutralizes the growth factor DPPA2. It has been shown to inhibit caspase-9 activity, which plays a crucial role in apoptosis. This antibody is formulated with excipients such as histidine and colloidal globulin to enhance stability and efficacy. It can be used in various applications in Life Sciences, including research on mesenchymal stem cells and alpha-fetoprotein. The DPPA2 antibody is a highly specific and potent tool for studying the function of DPPA2 and its role in cellular processes.FSHR antibody
The FSHR antibody is a neutralizing antibody that targets the follicle-stimulating hormone receptor (FSHR). It specifically binds to estrogen receptors and inhibits their activity. This antibody is commonly used in Life Sciences research to study hormone peptides, glycans, and tyrosine residues. It is available as both a monoclonal antibody and a polyclonal antibody.BSG antibody
The BSG antibody is a monoclonal antibody that specifically targets tumor necrosis factor-alpha (TNF-α). It is designed to bind to the glycan moiety of TNF-α, preventing its interaction with cell surface receptors. This antibody can be used in various research applications, such as immunohistochemistry and flow cytometry, to detect and quantify TNF-α levels. The BSG antibody has been extensively validated and shown to have high specificity and affinity for TNF-α. Its neutralizing properties make it a valuable tool for studying the role of TNF-α in various physiological and pathological processes. Additionally, this antibody has been used in therapeutic settings, such as the treatment of inflammatory diseases like rheumatoid arthritis, where excessive TNF-α production plays a key role in disease progression.PHACTR3 antibody
PHACTR3 antibody was raised using the C terminal of PHACTR3 corresponding to a region with amino acids IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR
