Primary Antibodies

The STAT5 antibody is a powerful tool in the field of Life Sciences. It is a polyclonal antibody that specifically targets and neutralizes tyrosinase, an enzyme involved in melanin production. This antibody can be used in various applications, such as immunohistochemistry, Western blotting, and ELISA assays. The STAT5 antibody has been extensively validated and has shown excellent specificity and sensitivity in detecting tyrosinase expression. It can be used to study melanoma progression, evaluate the efficacy of anti-tyrosinase therapies, and explore the role of tyrosinase in other biological processes. Whether you are a researcher or a pharmaceutical company working on developing new treatments for skin disorders, the STAT5 antibody is an essential tool for your studies.

FMO3 antibody was raised using the N terminal of FMO3 corresponding to a region with amino acids FMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTE

Loxl2 antibody was raised in rabbit using the C terminal of Loxl2 as the immunogen

Chymotrypsinogen B1 antibody was raised using the middle region of CTRB1 corresponding to a region with amino acids FKNPKFSILTVNNDITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCAT

hCG_1646157 antibody was raised in rabbit using the N terminal of HCG_1646157 as the immunogen

ACVR2B antibody was raised in rabbit using the middle region of ACVR2B as the immunogen

KIF9 antibody was raised using the N terminal of KIF9 corresponding to a region with amino acids MGTRKKVHAFVRVKPTDDFAHEMIRYGDDKRSIDIHLKKDIRRGVVNNQQ

IL1F5 antibody was raised in rabbit using the C terminal of IL1F5 as the immunogen

ADCY6 antibody was raised using the C terminal of ADCY6 corresponding to a region with amino acids LIYLVLLLLGPPATIFDNYDLLLGVHGLASSNETFDGLDCPAAGRVALKY

PRKCG antibody was raised using the N terminal of PRKCG corresponding to a region with amino acids FVVHRRCHEFVTFECPGAGKGPQTDDPRNKHKFRLHSYSSPTFCDHCGSL

IFT88 antibody was raised in rabbit using the middle region of IFT88 as the immunogen

CLEC4M antibody was raised using the N terminal of CLEC4M corresponding to a region with amino acids MSDSKEPRVQQLGLLEEDPTTSGIRLFPRDFQFQQIHGHKSSTGCLGHGA

The TAU antibody is a diagnostic agent used in immunochemical studies to detect the presence of TAU protein. It is particularly useful in detecting abnormal levels of TAU protein in human serum, cerebrospinal fluid, and primary neuron cultures. The TAU antibody specifically binds to TAU protein and can be used for the identification and quantification of TAU protein in various biological samples. This monoclonal antibody has high affinity and specificity for TAU protein, making it an excellent tool for research purposes. Whether you're studying synaptic proteins or investigating neurodegenerative diseases characterized by the accumulation of amyloid plaques, the TAU antibody is a valuable asset in your scientific arsenal.

KIF23 antibody was raised using the N terminal of KIF23 corresponding to a region with amino acids VRPLGFPDQECCIEVINNTTVQLHTPEGYRLNRNGDYKETQYSFKQVFGT

PHYH antibody was raised using the middle region of PHYH corresponding to a region with amino acids EKGDTVFFHPLLIHGSGQNKTQGFRKAISCHFASADCHYIDVKGTSQENI

MCT1 antibody was raised in rabbit using residues 3-14[KKFDEKENVSNC] of the 20 kDa MCT-1 protein as the immunogen.

Carboxylesterase 7 antibody was raised using the middle region of CES7 corresponding to a region with amino acids LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF

SPOCK3 antibody was raised using a synthetic peptide corresponding to a region with amino acids CPCPSDKPTSTSRNVKRACSDLEFREVANRLRDWFKALHESGSQNKKTKT

B4GALT2 antibody was raised using the middle region of B4GALT2 corresponding to a region with amino acids RLLIEFTSPMPLERVQRENPGVLMGGRYTPPDCTPAQTVAVIIPFRHREH

Plasminogen antibody was raised against Human Plasminogen.

REEP1 antibody was raised using the C terminal of REEP1 corresponding to a region with amino acids ERLRSFSMQDLTTIRGDGAPAPSGPPPPGSGRASGKHGQPKMSRSASESA

KLRA1 antibody was raised using the N terminal of KLRA1 corresponding to a region with amino acids NDQGEIYSTLRFLQSPSESQNRLRPDDTQRPGKTDDKEFSVPWHLIAVTL

DCX antibody was raised using a synthetic peptide corresponding to a region with amino acids TAGPKASPTPQKTSAKSPGPMRRSKSPADSANGTSSSQLSTPKSKQSPIS

KIF15 antibody was raised using the middle region of KIF15 corresponding to a region with amino acids SKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNEYNFKMRQL

PCDHA4 antibody was raised using the C terminal of PCDHA4 corresponding to a region with amino acids SGYNAWLSYELQPETASASIPFRVGLYTGEISTTRALDETDAPRQRLLVL

AP1B1 antibody was raised in rabbit using the C terminal of AP1B1 as the immunogen

EPO antibody was raised using the middle region of EPO corresponding to a region with amino acids  KEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGD

MAML3 antibody was raised in rabbit using the middle region of MAML3 as the immunogen

Exodus 2 antibody was raised in rabbit using highly pure recombinant murine exodus-2 as the immunogen.

Sohlh1 antibody was raised in rabbit using the middle region of Sohlh1 as the immunogen

SIN3B antibody was raised in rabbit using the middle region of SIN3B as the immunogen

The HIF1 alpha antibody is a highly specialized biomolecule used in the field of Life Sciences. It belongs to the class of Polyclonal Antibodies and Monoclonal Antibodies, which are widely recognized for their antigen-binding capabilities. This antibody specifically targets the growth factor known as interleukin-6 (IL-6), an important molecule involved in various biological processes.

ZC3H15 antibody was raised in rabbit using the middle region of ZC3H15 as the immunogen

Calmin antibody was raised using a synthetic peptide corresponding to a region with amino acids SPSSSLSPGSGGTDSDSSFPPTPTAERSVAISVKDQRKAIKALLAWVQRK

VCP antibody was raised in rabbit using the C terminal of VCP as the immunogen

OR2A5 antibody was raised in rabbit using the C terminal of OR2A5 as the immunogen

TUT1 antibody was raised in rabbit using the middle region of TUT1 as the immunogen

COMT antibody was raised using the middle region of COMT corresponding to a region with amino acids PDCAAITQRMVDFAGVKDKVTLVVGASQDIIPQLKKKYDVDTLDMVFLDH

Myocd antibody was raised in rabbit using the N terminal of Myocd as the immunogen

ZZZ3 antibody was raised in rabbit using the middle region of ZZZ3 as the immunogen

TRIM56 antibody was raised in rabbit using the middle region of TRIM56 as the immunogen

The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections and contains active compounds that exhibit bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, which inhibits bacterial growth and prevents transcription and replication. Extensive research has shown its high efficacy through the use of advanced techniques such as transcription-quantitative polymerase chain reaction and patch-clamp technique. Additionally, it undergoes various metabolic transformations, including hydrolysis by esterases, oxidation by cytochrome p450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Its specific binding to markers expressed in Mycobacterium tuberculosis strains further contributes to its effectiveness in inhibiting cell growth. Experience the power of 6-Fluoro-3-indoxyl-beta-D-gal