Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
BRMS1 antibody
The BRMS1 antibody is a glycoprotein that plays a crucial role in various biological processes. It has been shown to be activated in response to glutamate and is involved in the regulation of adipose tissue metabolism. This antibody can be used for electrophoresis studies, as well as for detecting and quantifying BRMS1 expression levels in different tissues. Additionally, it has anti-glial fibrillary acidic properties and can be used as a medicament for targeting specific cells or proteins. The BRMS1 antibody also interacts with collagen and other fatty acids, making it a versatile tool in the field of Life Sciences. With its reactive nature and polyclonal characteristics, this antibody offers immense potential for research and diagnostic applications.WDR12 antibody
WDR12 antibody was raised using the C terminal of WDR12 corresponding to a region with amino acids DTRSCKAPLYDLAAHEDKVLSVDWTDTGLLLSGGADNKLYSYRYSPTTSHPCBP4 antibody
PCBP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SVQGQYGAVTPAEVTKLQQLSSHAVPFATPSVVPGLDPGTQTSSQEFLVP
EPHA7 antibody
The EPHA7 antibody is a monoclonal antibody that targets the EPHA7 protein. This protein is involved in various cellular processes, including cell adhesion, migration, and proliferation. The EPHA7 antibody specifically binds to the EPHA7 protein, preventing its interaction with other molecules and inhibiting its function.Osteopontin antibody
The Osteopontin antibody is a highly effective Life Sciences product that falls under the category of Antibodies. It acts as a family kinase inhibitor and targets extracellular polysaccharides. This antibody has been extensively tested in various assays and has shown remarkable results in neutralizing activated TNF-α. Additionally, it has demonstrated its efficacy in colloidal and influenza hemagglutinin assays.APOL1 antibody
APOL1 antibody is a monoclonal antibody that specifically targets the 5-HT1A serotonin receptor. This antibody is widely used in Life Sciences research and is commonly used as a tool for studying the function and regulation of the 5-HT1A receptor. It has been shown to be highly specific and exhibits neutralizing activity against the receptor, making it an ideal choice for experiments involving the modulation of serotonin signaling pathways. The APOL1 antibody can be used in various applications, including immunoassays, Western blotting, and immunohistochemistry. Its high affinity and specificity ensure accurate and reliable results in research studies. Additionally, this antibody is available as a microsphere or colloidal conjugate, providing flexibility for different experimental setups. With its excellent performance and versatility, the APOL1 antibody is an essential tool for researchers studying serotonin receptors and their role in various physiological processes.
SYK antibody
The SYK antibody is a diagnostic reagent that belongs to the class of monoclonal antibodies. It is used in Life Sciences for various applications, including research and diagnostics. This antibody specifically targets and binds to spleen tyrosine kinase (SYK), an important protein involved in signaling pathways related to immune responses and cell growth. By neutralizing SYK, this antibody can be used to study the role of SYK in different cellular processes or as a potential therapeutic agent for diseases involving abnormal SYK activity. Additionally, the SYK antibody has been shown to have potential interactions with other proteins such as β-catenin and secretory phospholipase, indicating its versatility in experimental settings.DDX21 antibody
DDX21 antibody was raised using a synthetic peptide corresponding to a region with amino acids FRGQRDGNRRFRGQREGSRGPRGQRSGGGNKSNRSQNKGQKRSFSKAFGQMITD1 antibody
MITD1 antibody was raised using the middle region of MITD1 corresponding to a region with amino acids SHGVLLEVQYSSSIHDREIRFNNGWMIKIGRGLDYFKKPQSRFSLGYCDFRPL32 antibody
RPL32 antibody was raised using the N terminal of RPL32 corresponding to a region with amino acids AALRPLVKPKIVKKRTKKFIRHQSDRYVKIKRNWRKPRGIDNRVRRRFKGMIP1 alpha antibody (biotin)
MIP1 alpha antibody (biotin) was raised in rabbit using highly pure recombinant murine MIP-1a as the immunogen.
ANKRD7 antibody
ANKRD7 antibody was raised using the middle region of ANKRD7 corresponding to a region with amino acids SENKSPLIKAVQCQNEDCATILLNFGADPDLRDIRYNTVLHYAVCGQSLSFTO antibody
FTO antibody was raised using the middle region of FTO corresponding to a region with amino acids WWCQPMAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTAOGG1 antibody
The OGG1 antibody is a highly specialized monoclonal antibody that targets the OGG1 protein. This protein is involved in DNA repair and plays a crucial role in maintaining genomic stability. The OGG1 antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.FKHR antibody
The FKHR antibody is a diagnostic agent used in Life Sciences research. It specifically targets the epidermal growth factor (EGF) and is commonly used as a target molecule in various immunoassays. The FKHR antibody is a monoclonal antibody that binds to fibronectin, an important protein involved in cell adhesion and migration. This antibody can be used to detect and quantify the levels of EGF in biological samples, making it a valuable tool for studying growth factors and their role in cellular processes. Additionally, the FKHR antibody has been shown to have neutralizing properties, which makes it useful for blocking the activity of EGF and investigating its effects on cells. With its high specificity and sensitivity, the FKHR antibody is an essential tool for researchers working in the field of Life Sciences.IL18RAP antibody
IL18RAP antibody was raised using the N terminal of IL18RAP corresponding to a region with amino acids NRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCKIAA1704 antibody
KIAA1704 antibody was raised using the middle region of KIAA1704 corresponding to a region with amino acids KAAEDKNKPQERIPFDRDKDLKVNRFDEAQKKALIKKSRELNTRFSHGKGUBE2T antibody
The UBE2T antibody is a highly specialized product used in the field of Life Sciences. It is a polyclonal antibody that specifically targets UBE2T, a protein involved in various cellular processes. This antibody has been extensively tested and validated for its specificity and sensitivity.GPR151 antibody
The GPR151 antibody is a highly specialized monoclonal antibody that is used in the field of Life Sciences. It targets the p38 mitogen-activated protein phosphatase, which plays a crucial role in various cellular processes such as growth factor signaling and β-catenin activation. This antibody specifically recognizes and binds to the activated form of the p38 MAP phosphatase, allowing for its detection and analysis.
SAA antibody
SAA antibody is a monoclonal antibody that specifically targets serum amyloid A (SAA), a glycoprotein involved in the immune response and inflammation. This antibody has been extensively studied in the field of life sciences and has shown promising results in various applications. SAA antibody can be used for the detection and quantification of SAA levels, making it a valuable tool in research and diagnostic settings. Additionally, this monoclonal antibody has been used to study the role of SAA in diseases such as cancer, cardiovascular disorders, and autoimmune conditions. Its high specificity and affinity make it an ideal choice for experiments involving SAA, providing accurate and reliable results. With its ability to bind to SAA with precision, this antibody opens up new possibilities for understanding the mechanisms underlying these diseases and developing targeted therapies. Whether you're conducting cutting-edge research or working on diagnostic assays, SAA antibody is an indispensable tool that will help advance your scientific endeavors.
FBXO16 antibody
FBXO16 antibody was raised using the N terminal of FBXO16 corresponding to a region with amino acids CRKLQEKIPAEALDFTTKLPRVLSLYIFSFLDPRSLCRCAQVCWHWKNLANOD1 antibody
The NOD1 antibody is a highly sensitive detection tool used in immunoassays. It belongs to the family of antibodies used in Life Sciences research. This polyclonal antibody is specifically activated against amyloid plaque, making it an ideal tool for studying and detecting this protein in various biological samples. The NOD1 antibody can be utilized in a range of applications, including DNA vaccines, carbon electrode bioassays, and immunoassays targeting amyloid proteins. It is available both as a polyclonal and monoclonal antibody, ensuring flexibility for different experimental needs. With its high specificity and sensitivity, the NOD1 antibody is commonly used for detecting anti-beta amyloid antibodies in human serum or alpha-fetoprotein in various clinical and research settings.HEATR4 antibody
HEATR4 antibody was raised using the N terminal of HEATR4 corresponding to a region with amino acids VFFSSQYRLHRKSQYLKMAAANLTFSQEVVWQRGLPSIPYSQYSFDHLYN
