Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
SOCS2 antibody
The SOCS2 antibody is a monoclonal antibody that plays a crucial role in the field of Life Sciences. It specifically targets fatty acid, e-cadherin, and insulin antibodies. This antibody is widely used in research related to adipose tissue and adipocytes. It has been shown to have an impact on glycosylation and e-cadherin expression, which are important factors in various biological processes.GORASP1 antibody
GORASP1 antibody was raised using the N terminal of GORASP1 corresponding to a region with amino acids PYFDFIITIGHSRLNKENDTLKALLKANVEKPVKLEVFNMKTMRVREVEVCytokeratin 13 antibody
Cytokeratin 13 antibody was raised using the C terminal of KRT13 corresponding to a region with amino acids EAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKKRQPPAKAP1 antibody
AKAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids VPFSNGVLKGELSDLGAEDGWTMDAEADHSGVAAPPPGKRGTLITRCPGFNa, K ATPase antibody
Na, K ATPase antibody was raised in mouse using purified rat kidney Na, K ATPase as the immunogen.BDH1 antibody
BDH1 antibody was raised in Mouse using a purified recombinant fragment of human BDH1 expressed in E. coli as the immunogen.CYP2S1 antibody
The CYP2S1 antibody is a highly specialized insulin antibody that belongs to the group of polyclonal antibodies. It is specifically designed to target and neutralize tumor necrosis factor-alpha (TNF-α), a growth factor involved in various inflammatory processes. This monoclonal antibody has been extensively tested and proven effective in immunoassays, making it an invaluable tool for researchers studying TNF-α-related diseases. Additionally, the CYP2S1 antibody can be used in combination with other monoclonal antibodies to detect and quantify specific proteins, such as rubisco or insulin, in various biological samples. With its high specificity and sensitivity, this molecule drug holds great promise for advancing our understanding of complex molecular interactions and developing targeted therapies against TNF-α-mediated disorders.TRIB3 antibody
The TRIB3 antibody is a highly specialized polyclonal antibody used in the field of Life Sciences. It specifically targets and binds to the growth factor TRIB3, which plays a crucial role in various cellular processes. This antibody has been extensively studied and proven to be an effective tool for research purposes.SLC16A1 antibody
SLC16A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KPTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINESRRA antibody
ESRRA antibody was raised using the N terminal of ESRRA corresponding to a region with amino acids KEGVRLDRVRGGRQKYKRRPEVDPLPFPGPFPAGPLAVAGGPRKTAAPVNPDCD5 antibody
The PDCD5 antibody is a highly specialized monoclonal antibody used in Life Sciences. It is designed to target and bind to the protein known as Programmed Cell Death 5 (PDCD5). This antibody has been extensively studied for its potential therapeutic applications due to its ability to inhibit cell growth and induce apoptosis (programmed cell death).
LSM6 antibody
LSM6 antibody was raised using a synthetic peptide corresponding to a region with amino acids YRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRnNOS antibody
The nNOS antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody acts as an inhibitory factor against neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide in neurons. By specifically binding to nNOS, this antibody blocks its activity and prevents the production of nitric oxide.PIP5KL1 antibody
PIP5KL1 antibody was raised using the middle region of PIP5KL1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLPp53 antibody
The p53 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody binds to the tetramerization domain of the p53 protein, allowing for its detection in various tissues and cells. This antibody has been widely used in research and diagnostic applications to study the expression and localization of p53 in different diseases, including cancer. Its high specificity and sensitivity make it a valuable tool for understanding the molecular mechanisms underlying tumor development and progression.PPFIBP1 antibody
PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQMBNP antibody
The BNP antibody is an acidic polyclonal antibody that targets the growth factor B-type natriuretic peptide (BNP). It is commonly used in Life Sciences research to study the role of BNP in various physiological processes. The BNP antibody specifically binds to BNP and inhibits its interaction with receptors, thereby modulating endothelial growth and insulin signaling pathways. This antibody can also be used for diagnostic purposes to measure BNP levels in patient samples. Additionally, the BNP antibody has been utilized as a therapeutic agent in targeted cancer therapies, particularly in combination with anti-HER2 antibodies like trastuzumab. With its high specificity and affinity for BNP, this monoclonal antibody offers researchers and clinicians a valuable tool for studying and manipulating the natriuretic peptide system.
PKR antibody
The PKR antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with multiple options for their experiments. This antibody specifically targets the protein kinase RNA-activated (PKR) enzyme, which plays a crucial role in regulating cellular responses to various stimuli. The PKR antibody can be utilized in a wide range of assays, including Western blotting, immunohistochemistry, and immunofluorescence.eIF2 alpha antibody
The eIF2 alpha antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to eIF2 alpha, a protein involved in the regulation of translation initiation. This antibody is commonly used in studies related to insulin signaling, as well as in the development of therapeutic antibodies like trastuzumab and metoclopramide. In addition, it can be used as a tool for detecting eIF2 alpha autoantibodies or as a marker for identifying cells expressing high levels of this protein. The eIF2 alpha antibody has been proven to be highly specific and sensitive, making it an essential component in various research applications.SCGF antibody
The SCGF antibody is a peptide agent that belongs to the globulin class of proteins. It is widely used in Life Sciences research as a growth factor and basic protein. This antibody acts as an anticoagulant and can be used in various applications such as immunoassays, western blotting, and immunohistochemistry. The SCGF antibody can also be conjugated with streptavidin for enhanced detection or used in combination with monoclonal antibodies for neutralizing specific targets. Additionally, this antibody has been shown to have catalase activity, making it useful for studying oxidative stress and antioxidant mechanisms in human serum. With its versatility and high specificity, the SCGF antibody is an invaluable tool for researchers in a wide range of fields.
Claudin 7 antibody
The Claudin 7 antibody is a highly effective monoclonal antibody that targets the glycoprotein Claudin 7. It has anti-VEGF (vascular endothelial growth factor) properties and can inhibit the activity of epidermal growth factor. This antibody is widely used in Life Sciences research, particularly in studies related to antibodies, monoclonal antibodies, and polyclonal antibodies. The Claudin 7 antibody has been extensively characterized and is known for its high specificity and affinity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, ELISA, and flow cytometry. With its unique properties and versatility, the Claudin 7 antibody is an essential tool for scientists working in the field of molecular biology and cellular research.
