Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75562 products of "Primary Antibodies"
CD103 antibody (PE)
CD103 antibody (PE) was raised in hamster using murine CD103 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD20 antibody (PE-CY7)
CD20 antibody (PE) was raised in mouse using human CD20 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD11c antibody (FITC)
CD11c antibody (FITC) was raised in Mouse using human rheumatoid synovial fluid cells/monocytes as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD19 antibody (Allophycocyanin-CY7)
CD19 antibody (PE-Texas Red) was raised in mouse using human CD19 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD20 antibody (Spectral Red)
CD20 antibody (Spectral Red) was raised in mouse using human CD20 as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD90.2 antibody (Azide Free)
CD90.2 antibody (Azide free) was raised in rat using CD90.2/`Thy-1.2 alloantigen as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD26 antibody (biotin)
CD26 antibody (biotin) was raised in mouse using human ocular melanoma cell line V+B2 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCytokeratin 3 Antibody
The Cytokeratin 3 Antibody is a highly specialized antibody used in Life Sciences research. It is designed to specifically target and neutralize the leukemia inhibitory factor (LIF), a subtilisin/kexin type protein that plays a crucial role in various cellular processes such as insulin and growth factor signaling, epidermal growth, and fatty acid metabolism. This monoclonal antibody has been extensively validated for its high specificity and sensitivity in detecting and quantifying LIF levels in biological samples. It can be used in various applications including immunohistochemistry, western blotting, enzyme-linked immunosorbent assay (ELISA), and hybridization techniques. With its exceptional performance and reliability, the Cytokeratin 3 Antibody is an indispensable tool for researchers studying LIF-related pathways and exploring potential therapeutic targets for various diseases.Purity:Min. 95%CD117 antibody (Spectral Red)
CD117 antibody (Allophycocyanin-CY7) was raised in rat using murine CD117/c-Kit as the immunogen.
Purity:Min. 95%Molecular weight:0 g/molCD3 antibody (CY5)
CD3 antibody (CY5) was raised in mouse using the epsilon chain of CD3/T-cell antigen receptor complex as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD154 antibody (PE)
CD154 antibody (biotin) was raised in hamster using activated murine Th1 clone D1.6 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD117 antibody (Spectral Red)
CD117 antibody (FITC) was raised in rat using murine CD117/c-Kit as the immunogen.Purity:Min. 95%Molecular weight:0 g/molCD20 antibody (Allophycocyanin-CY7)
CD20 antibody (Allophycocyanin-CY7) was raised in mouse using human CD20 as the immunogen.Purity:Min. 95%Molecular weight:0 g/molSTRAP antibody
STRAP antibody was raised using the C terminal of STRAP corresponding to a region with amino acids ASGSEDGTLRLWQTVVGKTYGLWKCVLPEEDSGELAKPKIGFPETTEEEL
CLCC1 antibody
CLCC1 antibody was raised using the N terminal of CLCC1 corresponding to a region with amino acids MHYDAEIILKRETLLEIQKFLNGEDWKPGALDDALSDILINFKFHDFETWTNNI3K antibody
TNNI3K antibody was raised using the N terminal of TNNI3K corresponding to a region with amino acids LLKFGADVNVSGEVGDRPLHLASAKGFLNIAKLLMEEGSKADVNAQDNEDIntegrin beta 3 antibody
Integrin beta 3 antibody is a highly specialized antibody that targets and neutralizes the activity of TGF-β1 and IFN-gamma. This antibody has been extensively studied for its ability to bind to specific proteins involved in cell signaling pathways. It is available as both polyclonal and monoclonal antibodies, offering a wide range of options for researchers.Plexin B2 antibody
The Plexin B2 antibody is a biochemical compound that specifically targets estrogen receptors. It is a monoclonal antibody that has neuroprotective properties and can be used for various applications in the field of research and medicine. This antibody is highly specific and binds to denatured glycan structures, hormone peptides, and steroids. It also has the ability to recognize glycosylation patterns on proteins, making it a valuable tool for studying protein modifications. The Plexin B2 antibody is known for its neutralizing effects on certain molecules and can be used as an anti-connexin agent. It is produced through recombinant technology, ensuring high purity and consistency in every batch.
Cytokeratin 8 antibody
Cytokeratin 8 antibody was raised in mouse using cytoskeletal proteins from cultured Hela cells as the immunogen.MAGEA8 antibody
MAGEA8 antibody was raised using the N terminal of MAGEA8 corresponding to a region with amino acids EEVTDSGSPSPPQSPEGASSSLTVTDSTLWSQSDEGSSSNEEEGPSTSPDARP3 antibody
The ARP3 antibody is a highly specialized monoclonal antibody that targets extracellular histones. Histones play a crucial role in regulating gene expression through acetylation and other modifications. This antibody specifically binds to histones, inhibiting their activity and preventing them from interacting with other cellular components.
FBXO42 antibody
FBXO42 antibody was raised using the middle region of FBXO42 corresponding to a region with amino acids RSMDEAPCVNGRWGTLRPRAQRQTPSGSREGSLSPARGDGSPILNGGSLSMTHFS antibody
MTHFS antibody was raised using a synthetic peptide corresponding to a region with amino acids TSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAY
SHC antibody
The SHC antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets tyrosine residues and plays a crucial role in signal transduction pathways. The SHC antibody is known to interact with various proteins, including TNF-related apoptosis-inducing ligand (TRAIL), protein kinases, phosphatases, and fibrinogen. This antibody has been extensively studied for its potential therapeutic applications, such as in the development of targeted cancer therapies. It has also been used in the study of angiogenesis and microvessel density, as well as growth factor signaling pathways. Researchers rely on the high specificity and sensitivity of the SHC antibody to gain insights into complex cellular processes and advance scientific understanding.alpha Crystallin A antibody
alpha Crystallin A antibody was raised in mouse using recombinant human Crystallin alpha A (1-173aa) purified from E. coli as the immunogen.PAWR antibody
The PAWR antibody is a highly specialized product in the field of Life Sciences. It is an antibody specifically designed for the detection and analysis of pluripotent stem cells. Pluripotent stem cells are unique cells with the ability to differentiate into any type of cell in the human body, making them extremely valuable for scientific research and medical applications.
NSMCE2 antibody
NSMCE2 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFLALQSKNSDADFQNNEKFVQFKQQLKELKKQCGLQADREADGTEGVDERNF20 antibody
RNF20 antibody was raised using the middle region of RNF20 corresponding to a region with amino acids KEREREREREKEKEREREKQKLKESEKERDSAKDKEKGKHDDGRKKEAEIPARP12 antibody
PARP12 antibody was raised using a synthetic peptide corresponding to a region with amino acids FYDSCVNSVSDPSIFVIFEKHQVYPEYVIQYTTSSKPSVTPSILLALGSLCREBBP antibody
CREBBP antibody was raised using a synthetic peptide corresponding to a region with amino acids TPAASQALNPQAQKQVGLATSSPATSQTGPGICMNANFNQTHPGLLNSNS
CD20 antibody
CD20 antibody is a monoclonal antibody that specifically targets CD20, a protein found on the surface of B cells. This antibody is designed to neutralize CD20, preventing it from functioning properly. CD20 antibodies have been widely used in the field of Life Sciences for various applications. They can be used as research tools to study B cell function and development, as well as in diagnostic tests to identify and classify different types of B cell lymphomas.
