Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75562 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
KRT19 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug classified under rifamycins. It is specifically designed to treat tuberculosis infections by targeting the active compounds in bacteria and exerting bactericidal activity. This drug works by binding to DNA-dependent RNA polymerase, effectively preventing transcription and replication, inhibiting bacterial growth. Its high efficacy has been demonstrated through extensive research using the patch-clamp technique on human erythrocytes. Moreover, it undergoes various metabolic transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it exhibits specific binding to markers expressed at high levels in Mycobacterium tuberculosis strains, effectively inhibiting their growth in culture. With its multifaceted mechanism of action and targeted approach, 6-FluorohnRNP A1 Antibody
The hnRNP A1 Antibody is a highly reactive and neutralizing monoclonal antibody that is widely used in the field of Life Sciences. This antibody specifically targets hnRNP A1, a protein involved in various cellular processes such as RNA metabolism and splicing. The hnRNP A1 Antibody can be used for a variety of applications, including immunoprecipitation, western blotting, and immunofluorescence.MCP1 antibody
MCP1 antibody was raised in rabbit using highly pure recombinant human MCP-1(MCAF) as the immunogen.KRT19 antibody
The KRT19 antibody is a trifunctional monoclonal antibody that has been specifically designed for research purposes in the field of Life Sciences. It targets alpha-fetoprotein (AFP), a biomarker commonly used in cancer diagnostics. The KRT19 antibody is activated upon binding to AFP, leading to genotoxic effects and subsequent cell death. This unique bioassay enables researchers to study the role of AFP in various biological processes.PPP3CA antibody
PPP3CA antibody was raised using a synthetic peptide corresponding to a region with amino acids MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHLAK3L1 antibody
AK3L1 antibody was raised using the middle region of AK3L1 corresponding to a region with amino acids RWIHPPSGRVYNLDFNPPHVHGIDDVTGEPLVQQEDDKPEAVAARLRQYKRXRA antibody
RXRA antibody was raised using the N terminal of RXRA corresponding to a region with amino acids DTKHFLPLDFSTQVNSSLTSPTGRGSMAAPSLHPSLGPGIGSPGQLHSPIC6ORF134 antibody
C6ORF134 antibody was raised using the N terminal Of C6Orf134 corresponding to a region with amino acids MEFPFDVDALFPERITVLDQHLRPPARRPGTTTPARVDLQQQIMTIIDEL
CSRP1 antibody
The CSRP1 antibody is a monoclonal antibody that targets the CSRP1 protein, which plays a crucial role in regulating microvessel density. This antibody specifically binds to the CSRP1 cell antigen, neutralizing its activity and preventing the growth factor signaling pathway from being activated.CUTC antibody
CUTC antibody was raised using a synthetic peptide corresponding to a region with amino acids LEGLPLIKRLIEQAKGRIVVMPGGGITDRNLQRILEGSGATEFHCSARSTBRCA1 antibody
The BRCA1 antibody is a polyclonal antibody that specifically targets the BRCA1 protein. This protein plays a crucial role in DNA repair and maintenance of genomic stability. The BRCA1 antibody is highly reactive and can be used for various applications in life sciences research. It has been shown to effectively detect the expression of BRCA1 in human serum, tissues, and cell lines.PCNA antibody
PCNA antibody was raised in mouse using recombinant human PCNA (1-261aa) purified from E. coli as the immunogen.DAXX antibody
The DAXX antibody is a versatile and reactive antibody that is commonly used in life sciences research. It is designed to specifically target and bind to DAXX, a protein involved in various cellular processes. This antibody can be used in a wide range of applications, including immunofluorescence, immunohistochemistry, and Western blotting.CD90 Antibody
The CD90 Antibody is a highly effective anti-HER2 antibody that targets the growth factor receptor HER2. It is commonly used in combination with other therapies, such as trastuzumab, to treat HER2-positive breast cancer. This monoclonal antibody specifically binds to HER2 receptors, inhibiting their activation and preventing the growth and spread of cancer cells.HTR2A antibody
The HTR2A antibody is a potent inhibitor that targets the HTR2A receptor, which is involved in various cellular processes. This antibody can be used for hybridization experiments to study the expression and localization of the HTR2A receptor in different tissues. Additionally, it has cytotoxic properties and can be utilized for therapeutic purposes to selectively kill cells expressing high levels of the HTR2A receptor. The HTR2A antibody is also commonly used in life sciences research to investigate the role of this receptor in signal transduction pathways, protein kinase activation, and endothelial growth factor regulation. Furthermore, it has anti-angiogenic properties and can inhibit the growth of blood vessels by targeting vascular endothelial growth factor (VEGF). The HTR2A antibody is available as a polyclonal antibody, ensuring high specificity and sensitivity for detecting the HTR2A receptor in various experimental settings.MED8 antibody
MED8 antibody was raised using the N terminal of MED8 corresponding to a region with amino acids MQREEKQLEASLDALLSQVADLKNSLGSFICKLENEYGRLTWPSVLDSFAp27Kip1 antibody
The p27Kip1 antibody is a highly specialized biomolecule that plays a crucial role in cell cycle regulation. It acts as a phosphatase inhibitor and interacts with various growth factors, including TNF-α, to control cell proliferation. This monoclonal antibody has the unique ability to neutralize the effects of chemokines, preventing them from promoting inflammation and immune responses. Additionally, it has been used in ophthalmic formulations to target specific conditions such as diabetic retinopathy.
CPEB2 antibody
CPEB2 antibody was raised using the middle region of CPEB2 corresponding to a region with amino acids DTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLHelicase antibody
Helicase antibody was raised using a synthetic peptide corresponding to a region with amino acids FGRFPITGAWWRVKVQVKPVVGSRSYQYQVQGFPSYFLQSDMSPPNQKHITNRC6B antibody
TNRC6B antibody was raised using the N terminal of TNRC6B corresponding to a region with amino acids LQSESGTAPVWSKSTPPAPDNGTSAWGEPNESSPGWGEMDDTGASTTGWG
SCP2 antibody
SCP2 antibody was raised using the middle region of SCP2 corresponding to a region with amino acids NHKHSVNNPYSQFQDEYSLDEVMASKEVFDFLTILQCCPTSDGAAAAILAApoBEC3F antibody
ApoBEC3F antibody was raised using the middle region of APOBEC3F corresponding to a region with amino acids MYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVYSQVASP antibody
The VASP antibody is an inhibitory factor that targets various growth factors in the body. This monoclonal antibody specifically binds to histidine residues and has been extensively tested for its effectiveness. It is commonly used in research laboratories and medical facilities for experiments involving growth factors, such as hepatocyte growth factor, epidermal growth factor, c-myc, and leukemia inhibitory factor.NTHL1 antibody
NTHL1 antibody was raised in mouse using recombinant Human Nth Endonuclease Iii-Like 1 (E. Coli) (Nthl1)
