Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
ZRSR2 antibody
ZRSR2 antibody was raised using a synthetic peptide corresponding to a region with amino acids HHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHMetadherin antibody
Metadherin antibody was raised in Mouse using a purified recombinant fragment of human MTDH expressed in E. coli as the immunogen.ARG2 antibody
The ARG2 antibody is a highly specialized antibody that has a wide range of applications in the field of life sciences. It is commonly used in various assays and experiments to study the role of ARG2 in different biological processes.
MLL antibody
MLL antibody was raised in Mouse using a purified recombinant fragment of MLL(aa3751-3968) expressed in E. coli as the immunogen.Podocin antibody
The Podocin antibody is a powerful tool in the field of Life Sciences. It is widely used in various applications such as lectins, hybridization, growth factor studies, and anti-VEGF research. This antibody specifically targets podocin, a protein that plays a crucial role in kidney function and maintenance of the glomerular filtration barrier.
MOK antibody
MOK antibody is a specific antibody that targets the MOK antigen. It is commonly used in the field of life sciences for research purposes. This antibody can be used as a tool to study various cellular processes, including aminoacyl-tRNA synthesis, dopamine metabolism, and serotonin signaling. Additionally, MOK antibody has been shown to have inhibitory effects on certain enzymes and can be used as a therapeutic agent for diseases related to these enzymes. Furthermore, this antibody has been identified as a potential serum marker for certain medical conditions and may have diagnostic applications. With its wide range of applications and high specificity, MOK antibody is an essential tool for researchers in the field of life sciences.Nestin Antibody
The Nestin Antibody is a highly reactive monoclonal antibody that specifically targets the glial fibrillary acidic protein (GFAP). It is widely used in life sciences research to study the activation and differentiation of neural stem cells. The Nestin Antibody recognizes peptide antigens present in activated neural progenitor cells, making it an essential tool for investigating their behavior and function. Additionally, this antibody has been shown to inhibit the effects of interleukin-6 (IL-6) and leukemia inhibitory factor (LIF), which are known to influence neural cell differentiation and survival. The Nestin Antibody is commonly used in immunohistochemistry and immunocytochemistry experiments, providing researchers with valuable insights into the development and regeneration of the nervous system.MARCKS antibody
The MARCKS antibody is a non-phosphorylated monoclonal antibody that targets the protein MARCKS (Myristoylated Alanine-Rich C Kinase Substrate). This antibody specifically recognizes the non-phosphorylated form of MARCKS and can be used in various life science applications.ELK1 antibody
ELK1 antibody was raised in Mouse using a purified recombinant fragment of ELK1 expressed in E. coli as the immunogen.ALDH7A1 antibody
ALDH7A1 antibody was raised using the N terminal of ALDH7A1 corresponding to a region with amino acids NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQASRBM12 antibody
RBM12 antibody was raised using the N terminal of RBM12 corresponding to a region with amino acids PPPSSGMSSRVNLPTTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVGIL10 antibody
IL10 antibody was raised in rabbit using highly pure recombinant human IL-10 as the immunogen.C20ORF20 antibody
C20ORF20 antibody was raised using the middle region of C20Orf20 corresponding to a region with amino acids LSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKVMIEEEMKEEMTHYN1 antibody
THYN1 antibody was raised using the N terminal of THYN1 corresponding to a region with amino acids MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLERCC5 antibody
The ERCC5 antibody is a powerful inhibitor that targets lyso-gb1, a substance involved in various biological processes. This antibody has been extensively studied in the field of Life Sciences and has shown promising results as a therapeutic agent. It is widely used in research laboratories and pharmaceutical companies for its ability to specifically bind to lyso-gb1 and inhibit its activity.HDAC8 antibody
The HDAC8 antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to the histone deacetylase 8 (HDAC8) protein, which plays a crucial role in regulating gene expression. By targeting HDAC8, this antibody can modulate the activity of growth factors, tyrosine kinases, interferons, and fatty acids.GAN antibody
GAN antibody was raised using the middle region of GAN corresponding to a region with amino acids IYLNDQNLCIPASSSFVYGAVPIGASIYVIGDLDTGTNYDYVREFKRSTGUBC9 antibody
The UBC9 antibody is a polyclonal antibody that targets the UBC9 protein. UBC9 plays a crucial role in the modification of proteins by attaching small ubiquitin-like modifier (SUMO) proteins to target proteins. This process, known as SUMOylation, regulates various cellular processes such as DNA repair, transcriptional regulation, and protein localization.FES antibody
FES antibody was raised in Mouse using a purified recombinant fragment of FES expressed in E. coli as the immunogen.LCK antibody
LCK antibody was raised in Mouse using a purified recombinant fragment of human Lck expressed in E. coli as the immunogen.MRPS6 antibody
MRPS6 antibody was raised using the middle region of MRPS6 corresponding to a region with amino acids VESMVEHLSRDIDVIRGNIVKHPLTQELKECEGIVPVPLAEKLYSTKKRKIL8 antibody
IL8 antibody was raised in rabbit using highly pure recombinant human IL-8 as the immunogen.HER3 antibody
The HER3 antibody is a phosphatase that belongs to the class of antibodies. It is a monoclonal antibody that specifically targets HER3, a receptor protein that plays a crucial role in cell growth and survival. This antibody has been shown to inhibit the interaction between HER3 and its ligand, preventing the activation of downstream signaling pathways involved in cancer progression.
