Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75594 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PSAT1 antibody
The PSAT1 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. This antibody specifically targets the cholinergic basic protein PSAT1, which plays a crucial role in various biological processes. The PSAT1 antibody is commonly used for research purposes, including the study of protein interactions, signal transduction pathways, and cellular functions.DCUN1D1 antibody
DCUN1D1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKATG4A antibody
ATG4A antibody was raised using a synthetic peptide corresponding to a region with amino acids DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDRAdenovirus antibody
Adenovirus antibody was raised in mouse using hexon antigen of human adenovirus as the immunogen.TEL antibody
TEL antibody is a monoclonal antibody that specifically targets the TEL protein. This protein plays a crucial role in various cellular processes, including cell proliferation, differentiation, and apoptosis. The TEL antibody has been extensively studied for its potential therapeutic applications in cancer treatment.C7ORF31 antibody
C7ORF31 antibody was raised using the N terminal Of C7Orf31 corresponding to a region with amino acids EVIHGRPYCCRELEGADILSNTFYSNELHNPLQTVTRPTASEDRYQELRECeruloplasmin antibody
The Ceruloplasmin antibody is a highly specialized product in the field of Life Sciences. It is an antibody that specifically targets and binds to ceruloplasmin, a protein found in human serum. This antibody recognizes the carbonyl group and amino group of ceruloplasmin, making it an essential tool for research on this protein.ETFB antibody
ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP
WDR21B antibody
WDR21B antibody was raised using the middle region of WDR21B corresponding to a region with amino acids HEEEGIVVAVGQDCYTRIWSLHDAHLLRTIPSPYSASEDDIPSVAFASRLNDRG2 antibody
NDRG2 antibody was raised using the C terminal of NDRG2 corresponding to a region with amino acids GYMASSCMTRLSRSRTASLTSAASVDGNRSRSRTLSQSSESGTLSSGPPG
CK2A1 antibody
The CK2A1 antibody is a highly specialized product in the field of Life Sciences. It is designed to target and neutralize glucose-6-phosphate, sclerostin, and other EGF-like proteins. This monoclonal antibody has been extensively tested and validated for its efficacy in various assays. The CK2A1 antibody is produced using state-of-the-art technology and quality control measures to ensure its purity and specificity. It is commonly used by researchers and scientists to study the role of these proteins in various biological processes. With its high affinity and specificity, the CK2A1 antibody is an essential tool for anyone working in the field of molecular biology or protein research.Treponema pallidum antibody
6-Fluoro-3-indoxyl-beta-D-galactopyranoside is an antituberculosis drug belonging to the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by inhibiting bacterial growth through binding to DNA-dependent RNA polymerase, preventing transcription and replication. The effectiveness of this drug has been demonstrated through patch-clamp technique studies on human erythrocytes. Metabolically, it undergoes various transformations such as hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, 6-Fluoro-3-indoxyl-beta-D-galactopyranoside specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains, inhibiting their cell growth in culture.
TRA1 antibody
TRA1 antibody was raised in mouse using recombinant human TRA1 (676-803aa) purified from E. coli as the immunogen.KCNA10 antibody
KCNA10 antibody was raised using the N terminal of KCNA10 corresponding to a region with amino acids DVCGWKEMEVALVNFDNSDEIQEEPGYATDFDSTSPKGRPGGSSFSNGKI
PFKP antibody
The PFKP antibody is a highly specialized monoclonal antibody used in Life Sciences research. It targets the PFKP protein, which plays a crucial role in cellular metabolism and energy production. This antibody has been shown to neutralize the activity of catalase, an enzyme involved in oxidative stress response.E Cadherin antibody
The E Cadherin antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets E-cadherin, a protein involved in cell adhesion and cell signaling. This antibody can be used for various applications, including immunohistochemistry, Western blotting, and flow cytometry. It has been shown to have antiviral properties and can neutralize the activity of certain growth factors and chemokines. Additionally, the E Cadherin antibody has been used in studies involving granulosa cells and colony-stimulating factor. Its high specificity and affinity make it a valuable tool for researchers in the field of Life Sciences.iNOS antibody
The iNOS antibody is a specific antibody that targets inducible nitric oxide synthase (iNOS), an enzyme involved in the production of nitric oxide. This antibody has been shown to be highly effective in detecting and quantifying iNOS expression in various biological samples. It can be used for research purposes in fields such as life sciences, immunology, and cell biology.IMPA1 antibody
IMPA1 antibody was raised using the middle region of IMPA1 corresponding to a region with amino acids IVTEAGGVLMDVTGGPFDLMSRRVIAANNRILAERIAKEIQVIPLQRDDENRG1 antibody
The NRG1 antibody is a powerful therapeutic tool in the field of Life Sciences. It acts as a DPP4 inhibitor, targeting and inhibiting the activity of dipeptidyl peptidase-4. This antibody has been extensively studied for its potential applications in various areas, including adipose tissue research, interferon signaling pathways, and choroidal neovascularization.IL3 antibody
The IL3 antibody is a polyclonal antibody that is used for the immobilization of gm-csf, a colony-stimulating factor. It can be used in various applications such as ELISA and western blotting. The IL3 antibody has been shown to have high specificity and sensitivity when tested with human serum samples. It can also be used in conjunction with other antibodies, such as phalloidin, to study the effects of steroids on cell growth and differentiation. Additionally, monoclonal antibodies against tgf-β1 have been developed using flavobacterium heparinum as an immunogen. These antibodies have been shown to inhibit the cytotoxic effects of tgf-β1 and may have potential therapeutic applications in cancer treatment.AK3 antibody
AK3 antibody is a monoclonal antibody widely used in various assays and experiments in the field of Life Sciences. It is specifically designed to target and bind to AK3, an important glycoprotein involved in various cellular processes. This antibody has been shown to be highly specific and sensitive in detecting the presence of AK3 in samples.ACTA antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the class of rifamycins. It is highly effective in treating tuberculosis infections. This active compound exhibits bactericidal activity by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Its potency has been demonstrated through various scientific techniques such as the patch-clamp technique on human erythrocytes. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth in culture.NMDAR2B antibody
The NMDAR2B antibody is a pharmacological tool that belongs to the class of antibodies. It is used in Life Sciences research to study the role of NMDA receptors, specifically the NMDAR2B subunit, in various cellular processes. This antibody has been shown to modulate intracellular calcium levels and lactate production. It also interacts with other proteins such as apolipoprotein and fibrinogen, suggesting its involvement in multiple signaling pathways. The NMDAR2B antibody can be used as an inhibitor to block the activity of NMDA receptors and investigate their function in different experimental settings. Its high specificity and affinity make it a valuable tool for researchers in the field of neuroscience and drug discovery.DNA2L antibody
DNA2L antibody was raised using the middle region of Dna2L corresponding to a region with amino acids KLELEFYADYSDNPWLMGVFEPNNPVCFLNTDKVPAPEQVEKGGVSNVTEHOMER1 antibody
HOMER1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QEQRDSLTQKLQEVEIRNKDLEGQLSDLEQRLEKSQNEQEAFRNNLKTLL
