Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
HNRNPC antibody
HNRNPC antibody was raised using a synthetic peptide corresponding to a region with amino acids ESEGGADDSAEEGDLLDDDDNEDRGDDQLELIKDDEKEAEEGEDDRDSAN
NGAL antibody
The NGAL antibody is a highly specialized monoclonal antibody that has been extensively studied in the field of Life Sciences. It is an 8-substituted antibody that exhibits glycosylation, making it highly effective in targeting specific molecules and proteins within the body. The NGAL antibody has shown promising results in inhibiting interleukin-6, a key growth factor involved in various inflammatory processes. Additionally, this antibody has demonstrated its efficacy in neutralizing antibodies such as erythropoietin and epidermal growth factor, which play crucial roles in certain diseases. The NGAL antibody's unique structure allows it to bind specifically to tyrosine residues on target molecules, enabling precise targeting and modulation of cellular functions. Its binding affinity has been proven through rigorous laboratory testing using state-of-the-art electrode techniques. In recent studies, the NGAL antibody has shown potential therapeutic effects against Helicobacter pylori infection, a bacteria known for causing gastric ulcers and other gastrointestinal disorders. Furthermore, thisClaudin 18 antibody
Claudin 18 antibody was raised using the C terminal of CLDN18 corresponding to a region with amino acids PEETNYKAVSYHASGHSVAYKPGGFKASTGFGSNTKNKKIYDGGARTEDEPurity:Min. 95%CDKL5 antibody
The CDKL5 antibody is a highly specialized monoclonal antibody used in Life Sciences research. It specifically targets the CDKL5 protein, which plays a crucial role in various cellular processes. The antibody works by binding to the CDKL5 protein and inhibiting its activity, allowing researchers to study its function and potential therapeutic applications.nNOS antibody
The nNOS antibody is a highly specialized product in the field of Life Sciences. This monoclonal antibody acts as an inhibitory factor against neuronal nitric oxide synthase (nNOS), an enzyme involved in the production of nitric oxide in neurons. By specifically binding to nNOS, this antibody blocks its activity and prevents the production of nitric oxide.PIP5KL1 antibody
PIP5KL1 antibody was raised using the middle region of PIP5KL1 corresponding to a region with amino acids VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLPp53 antibody
The p53 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the p53 protein, which plays a crucial role in regulating cell growth and preventing tumor formation. The p53 antibody binds to the tetramerization domain of the p53 protein, allowing for its detection in various tissues and cells. This antibody has been widely used in research and diagnostic applications to study the expression and localization of p53 in different diseases, including cancer. Its high specificity and sensitivity make it a valuable tool for understanding the molecular mechanisms underlying tumor development and progression.PPFIBP1 antibody
PPFIBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PFMGSLRALHLVEDLRGLLEMMETDEKEGLRCQIPDSTAETLVEWLQSQMBNP antibody
The BNP antibody is an acidic polyclonal antibody that targets the growth factor B-type natriuretic peptide (BNP). It is commonly used in Life Sciences research to study the role of BNP in various physiological processes. The BNP antibody specifically binds to BNP and inhibits its interaction with receptors, thereby modulating endothelial growth and insulin signaling pathways. This antibody can also be used for diagnostic purposes to measure BNP levels in patient samples. Additionally, the BNP antibody has been utilized as a therapeutic agent in targeted cancer therapies, particularly in combination with anti-HER2 antibodies like trastuzumab. With its high specificity and affinity for BNP, this monoclonal antibody offers researchers and clinicians a valuable tool for studying and manipulating the natriuretic peptide system.
PKR antibody
The PKR antibody is a highly effective tool used in Life Sciences research. It is available as both polyclonal and monoclonal antibodies, providing researchers with multiple options for their experiments. This antibody specifically targets the protein kinase RNA-activated (PKR) enzyme, which plays a crucial role in regulating cellular responses to various stimuli. The PKR antibody can be utilized in a wide range of assays, including Western blotting, immunohistochemistry, and immunofluorescence.eIF2 alpha antibody
The eIF2 alpha antibody is a polyclonal antibody used in Life Sciences research. It specifically targets and binds to eIF2 alpha, a protein involved in the regulation of translation initiation. This antibody is commonly used in studies related to insulin signaling, as well as in the development of therapeutic antibodies like trastuzumab and metoclopramide. In addition, it can be used as a tool for detecting eIF2 alpha autoantibodies or as a marker for identifying cells expressing high levels of this protein. The eIF2 alpha antibody has been proven to be highly specific and sensitive, making it an essential component in various research applications.SCGF antibody
The SCGF antibody is a peptide agent that belongs to the globulin class of proteins. It is widely used in Life Sciences research as a growth factor and basic protein. This antibody acts as an anticoagulant and can be used in various applications such as immunoassays, western blotting, and immunohistochemistry. The SCGF antibody can also be conjugated with streptavidin for enhanced detection or used in combination with monoclonal antibodies for neutralizing specific targets. Additionally, this antibody has been shown to have catalase activity, making it useful for studying oxidative stress and antioxidant mechanisms in human serum. With its versatility and high specificity, the SCGF antibody is an invaluable tool for researchers in a wide range of fields.
Claudin 7 antibody
The Claudin 7 antibody is a highly effective monoclonal antibody that targets the glycoprotein Claudin 7. It has anti-VEGF (vascular endothelial growth factor) properties and can inhibit the activity of epidermal growth factor. This antibody is widely used in Life Sciences research, particularly in studies related to antibodies, monoclonal antibodies, and polyclonal antibodies. The Claudin 7 antibody has been extensively characterized and is known for its high specificity and affinity for its target. It can be used in various applications such as immunohistochemistry, Western blotting, ELISA, and flow cytometry. With its unique properties and versatility, the Claudin 7 antibody is an essential tool for scientists working in the field of molecular biology and cellular research.Salmonella antibody
Salmonella antibody was raised in mouse using flagellum protein present in most Salmonella species as the immunogen.AKT2 antibody
AKT2 antibody was raised in Mouse using a purified recombinant fragment of human Akt2 expressed in E. coli as the immunogen.Cyclin A antibody
The Cyclin A antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets cyclin A, a protein involved in cell cycle regulation. This antibody can be used to study the role of cyclin A in various cellular processes, including DNA replication and cell division. Additionally, it has been shown to have potential applications in the detection of insulin-like autoantibodies and alpha-synuclein antigen. The Cyclin A antibody is highly specific and sensitive, making it a valuable tool for researchers studying hormone peptides, growth factors, and virus surface antigens. With its ability to detect activated proteins, this antibody is essential for understanding the complex mechanisms of cellular signaling pathways.Insulin+Proinsulin antibody
Insulin/proinsulin antibody was raised in mouse using purified mouse Insulin and proinsulin as the immunogen.GBL antibody
GBL antibody was raised using a synthetic peptide corresponding to a region with amino acids CAFSGDSQYIVTASSDNLARLWCVETGEIKREYGGHQKAVVCLAFNDSVLST14 antibody
ST14 antibody is a monoclonal antibody that targets protein kinase ST14. It is widely used in Life Sciences research for its ability to specifically bind to ST14 and inhibit its activity. This antibody has been shown to effectively block the function of ST14, preventing its interaction with other proteins and interfering with various cellular processes. Additionally, ST14 antibody has been used in studies involving albumin, inhibitors, antibodies, tyrosine, alpha-synuclein, activated mitogen-activated protein (MAP) kinases, collagen, and glucose transporter. It is also known to enhance the cytotoxic effects of certain anti-CD20 antibodies. With its high specificity and potency, ST14 antibody is a valuable tool for scientists studying protein kinase signaling pathways and their role in disease development and progression.
HORMAD2 antibody
HORMAD2 antibody was raised using the middle region of HORMAD2 corresponding to a region with amino acids YTDPMGSEKVTEMYQFKFKYTKEGATMDFDSHSSSTSFESGTNNEDIKKAALDH2 antibody
The ALDH2 antibody is an activated basic protein that falls under the category of Life Sciences. It is a monoclonal antibody that targets ALDH2, an enzyme involved in the metabolism of alcohol and other aldehydes. This antibody has been widely used in research studies to investigate the role of ALDH2 in various biological processes.
