Primary Antibodies

ERRFI1 antibody was raised in Rabbit using Human ERRFI1 as the immunogen

CD5 antibody was raised in mouse using feline CD5 as the immunogen.

CBR4 antibody was raised in rabbit using the N terminal of CBR4 as the immunogen

Purified Rabbit polyclonal MADS68 antibody

TCF3 antibody was raised in Mouse using a purified recombinant fragment of human TCF3 expressed in E. coli as the immunogen.

DAXX antibody was raised in Mouse using a purified recombinant fragment of human DAXX expressed in E. coli as the immunogen.

The CNOT2 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is specifically designed to target and inhibit the activity of CNOT2, a key protein involved in epidermal growth and endothelial growth factor signaling pathways. This antibody has been extensively studied and shown to have potent anti-HER2 activity, making it an ideal candidate for targeted therapy against HER2-positive cancers.

DDAH1 antibody was raised using the middle region of DDAH1 corresponding to a region with amino acids ALEKLQLNIVEMKDENATLDGGDVLFTGREFFVGLSKRTNQRGAEILADT

The Cathepsin D antibody is a highly effective and specific monoclonal antibody that targets the active enzyme Cathepsin D. This antibody has been extensively studied in the field of Life Sciences and has shown great potential for various applications. It binds specifically to Cathepsin D, inhibiting its enzymatic activity and preventing it from binding to its receptors.

CACNB2 antibody was raised using the N terminal of CACNB2 corresponding to a region with amino acids IQMELLENVAPAGALGAAAQSYGKGARRKNRFKGSDGSTSSDTTSNSFVR

BRMS1L antibody was raised in rabbit using the C terminal of BRMS1L as the immunogen

Rabbit polyclonal TADA3 antibody

ERLIN1 antibody was raised in Rabbit using Human ERLIN1 as the immunogen

The CAD antibody is a highly versatile biomolecule that plays a crucial role in various Life Sciences applications. This polyclonal antibody specifically targets and neutralizes CAD (carbamoyl-phosphate synthetase 2, aspartate transcarbamylase, and dihydroorotase), an essential enzyme involved in the de novo pyrimidine biosynthesis pathway.

SH3KBP1 antibody was raised using the N terminal of SH3KBP1 corresponding to a region with amino acids TGMFPSNFIKELSGESDELGISQDEQLSKSSLRETTGSESDGGDSSSTKS

Rabbit polyclonal RFWD2 antibody

FKBPL antibody was raised using the N terminal of FKBPL corresponding to a region with amino acids AELEGDSHKSHGSTSQMPEALQASDLWYCPDGSFVKKIVIRGHGLDKPKL

The P19 INK4d antibody is a polyclonal antibody that specifically targets human serum albumin. It recognizes and binds to the hormone peptide, glycation, and EGF-like domains of human serum albumin. This antibody can be used for various applications including immunohistochemistry, western blotting, and ELISA assays. It has been extensively characterized and validated for its specificity and sensitivity. The P19 INK4d antibody is also available as a monoclonal antibody for more specific targeting of vasoactive intestinal peptide and other growth factors. It can be purified using chromatographic techniques and can be used for neutralizing chemokine activity in various biological systems.

Purified Polyclonal ZIP9 antibody

HIST1H2AH antibody was raised in rabbit using the C terminal of HIST1H2AH as the immunogen

ZBTB7B antibody was raised in Mouse using a purified recombinant fragment of human ZBTB7B expressed in E. coli as the immunogen.

Rabbit polyclonal IRF2 antibody

The GFR alpha antibody is a highly effective antiviral agent that targets low-density lipoprotein lipase and transferrin. This polyclonal antibody is specifically designed to bind to collagen and electrodes, making it an ideal tool for various research applications in the life sciences field. Additionally, this monoclonal antibody has shown promising results in inhibiting interferon production and neutralizing viral activity. With its ability to interact with chimeric proteins and fatty acids, the GFR alpha antibody offers a versatile solution for studying immune responses and developing therapeutic interventions. It is extensively tested and validated in human serum samples, ensuring reliable and accurate results. Choose this exceptional antibody for your research needs today.

The Keratin 18 antibody is a highly specialized antibody that specifically targets and binds to Keratin 18, a protein involved in cellular structure and growth. This antibody has been extensively studied and proven to be effective in various applications within the field of Life Sciences.

ITGBL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MRPPGFRNFLLLASSLLFAGLSAVPQSFSPSLRSWPGAACRLSRAESERR

Rabbit polyclonal PELO antibody

p53 antibody is an antiviral agent that targets the p53 protein, a key regulator of cell division and apoptosis. This antibody binds to the p53 protein and inhibits its function, preventing viral replication and spread. Additionally, it has been shown to have chemokine-like properties, attracting mesenchymal stem cells to the site of infection for tissue repair. In Life Sciences, this antibody is widely used in research and diagnostic applications for studying intraocular diseases and detecting autoantibodies. It can also be used as a tool for telomerase inhibition or as an inhibitor of fibroin production. The p53 antibody is available in both polyclonal and monoclonal forms, with neutralizing activity against the p53 antigen. Its high specificity ensures reliable results in antigen-antibody reactions. Choose the p53 antibody for your research needs and unlock new insights into cellular processes and disease mechanisms.

EIF3G antibody was raised in Rabbit using Human EIF3G as the immunogen

Rabbit polyclonal UBXD5 antibody

Rabbit polyclonal RANK antibody (biotin)

C12ORF42 antibody was raised using the N terminal Of C12Orf42 corresponding to a region with amino acids PRCSVSTVSFDEESYEEFRSSPAPSSETDEAPLIFTARGETEERARGAPK

The FAK antibody is a powerful tool in the field of Life Sciences. This steroid-based antibody is designed to target and neutralize specific proteins, such as anti-mesothelin antibodies, in order to study their function and potential therapeutic applications. The FAK antibody has been shown to inhibit the growth and proliferation of cancer cells by blocking the activity of epidermal growth factor (EGF) and its receptor. Additionally, this antibody has cytotoxic properties, making it an effective tool for targeted cell killing in research experiments. The FAK antibody is highly reactive and can be used to detect and quantify the presence of specific proteins in samples, such as human serum or tissue extracts. Its specificity and sensitivity make it an essential tool for researchers working in various fields of study, including oncology, immunology, and cell biology.

TMEM16C antibody was raised using the middle region of TMEM16C corresponding to a region with amino acids  WWSRHKIKRGIHDASIPQWENDWNLQPMNLHGLMDEYLEMVLQFGFTTIF

The TAP1 Antibody is a powerful tool used in Life Sciences research. This monoclonal antibody specifically targets the TAP1 protein isoforms, which play a crucial role in antigen presentation and immune response. By binding to the TAP1 protein, this antibody allows for the detection and analysis of threonine phosphorylation and other post-translational modifications.

Purified Polyclonal G3BP2 antibody

Rabbit polyclonal DNA Polymerase beta antibody

AREG antibody was raised in Rabbit using Human AREG as the immunogen

Rabbit polyclonal FXR2 antibody

The Myb antibody is a polyclonal antibody that specifically targets annexin A2. It is commonly used in research and laboratory settings to study the function and regulation of annexin A2. This antibody can be used in various applications, including immunohistochemistry, Western blotting, and immunofluorescence assays. The Myb antibody has been proven to be highly specific and sensitive, providing reliable results in experiments. It can also be used in combination with other antibodies or inhibitors to study the interaction between annexin A2 and other molecules, such as chemokines or glucagon. Whether you are studying cardiomyocytes or conducting multidrug resistance assays, the Myb antibody is an essential tool for your research needs.

The SOX9 antibody is a highly specialized monoclonal antibody used in the field of Life Sciences. It is commonly used for immunoassays and research purposes. This antibody specifically targets the SOX9 protein, which is a critical growth factor involved in various cellular processes. The SOX9 antibody can be utilized to study the expression and localization of this protein in different tissues and cell types.

ASRGL1 antibody was raised in Rabbit using Human ASRGL1 as the immunogen