Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
PFKL antibody
The PFKL antibody is a monoclonal antibody that targets amyloid protein and has various characteristics and applications. It has been shown to inhibit the production of chemokines and TNF-α, which are involved in inflammatory responses. Additionally, the PFKL antibody has been used in studies related to Brucella abortus infection, adipose tissue regulation, adeno-associated viruses, and calmodulin signaling.SLPI antibody
The SLPI antibody is a polyclonal antibody that specifically targets SLPI (Secretory Leukocyte Protease Inhibitor), a protein found in human serum and various tissues. This antibody is widely used in life sciences research and diagnostics. It can be used for various applications, including immunohistochemistry, Western blotting, ELISA, and flow cytometry.hnRNP K antibody
The hnRNP K antibody is a polyclonal antibody that is used in Life Sciences research. It specifically targets hnRNP K, a protein involved in various cellular processes including RNA metabolism and transcriptional regulation. This antibody can be used to study the role of hnRNP K in different biological pathways and its interactions with other proteins such as epidermal growth factor and synaptic proteins. Additionally, the hnRNP K antibody has been shown to have neutralizing properties against certain growth factors like hepatocyte growth factor. It is highly specific and does not cross-react with other proteins or undergo denaturation when exposed to benzalkonium chloride or n-ethylmaleimide-sensitive factor. With its ability to detect different isoforms of hnRNP K, this antibody is a valuable tool for researchers studying gene expression and protein function.AK3 antibody
The AK3 antibody is a monoclonal antibody that specifically targets the growth factor AK3. It has been widely used in research and diagnostics to detect the presence of AK3 in various biological samples. The AK3 antibody emits a strong signal when bound to its target, making it highly sensitive and reliable for detecting AK3 levels. Additionally, this monoclonal antibody has been shown to have high affinity and specificity for AK3, ensuring accurate and precise results. Whether you're studying angiogenesis, tumor development, or any other life science-related field, the AK3 antibody is an essential tool for your research. With its ability to accurately measure microvessel density and detect alpha-synuclein in blood plasma, this monoclonal antibody opens up new avenues for understanding disease mechanisms and developing targeted therapies. Trust the power of magnetic particles conjugated with the AK3 monoclonal antibodies for your next experiment or diagnostic assay.CFTR antibody
CFTR antibody was raised in mouse using a synthetic peptide(RKGYRQRLELSD) corresponding to residues 25-36 of human cystic fibrosis transmembrane conductance regulator (CFTR) as the immunogen.PFAS antibody
PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGLUNQ1887 antibody
UNQ1887 antibody was raised using the middle region of UNQ1887 corresponding to a region with amino acids VMVKVATQPADNPLDVLSRKLHLGPNVGRDVPRLSLPGKLVFPSSTGSHFRORC antibody
RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKASRTDR1 antibody
RTDR1 antibody was raised using the middle region of RTDR1 corresponding to a region with amino acids IARLNATKALTMLAEAPEGRKALQTHVPTFRAMEVETYEKPQVAEALQRAPSMA antibody
PSMA antibody was raised in mouse using recombinant human PSMA (117-351aa) purified from E. coli as the immunogen.S6K1 antibody
S6K1 antibody is a highly specific and potent phosphatase that plays a crucial role in various cellular processes. It contains a cycloalkyl group that allows for activation and binding to its target. This antibody has been extensively studied and proven to be effective in detecting and quantifying S6K1 levels in biological samples.EPS8L2 antibody
The EPS8L2 antibody is a specific antibody that targets the EPS8-like 2 protein. This protein is involved in various cellular processes, including dopamine signaling and phosphatase activity. The EPS8L2 antibody is commonly used in life sciences research, particularly in studies related to fetal hemoglobin and pluripotent stem cells. It can be used in assays to detect and quantify EPS8L2 protein levels in different samples. Additionally, this antibody has potential applications in the development of new medicines, as it may serve as a therapeutic target for certain diseases. Its binding properties make it suitable for use in adeno-associated virus-mediated gene delivery or as a tool to study G-protein-coupled receptor inhibitors. The EPS8L2 antibody is highly specific and recognizes specific epitopes on the EPS8L2 protein, making it an essential tool for researchers in the field of molecular biology and biochemistry.PLAU antibody
PLAU antibody is a monoclonal antibody that targets the growth factor PLAU. It specifically binds to PLAU and inhibits its activity, leading to a decrease in cell proliferation and migration. This antibody can be used in various applications, such as immunohistochemistry, western blotting, and ELISA. The antigen-antibody reaction between PLAU and the antibody is highly specific and sensitive, making it a valuable tool for research in the field of life sciences. Additionally, this antibody has been shown to have potential therapeutic applications in the treatment of diseases such as cancer and cardiovascular disorders.Benzodiazepine antibody
Benzodiazepine antibody was raised in mouse using benzodiazepine-BSA as the immunogen.LIPI antibody
LIPI antibody was raised using the middle region of LIPI corresponding to a region with amino acids YFVLSIIVPDKTMMDGSFSFKLLNQLGMIEEPRLYEKNKPFYKLQEVKILGATA1 antibody
GATA1 antibody was raised in Mouse using a purified recombinant fragment of human GATA1 expressed in E. coli as the immunogen.KCNJ8 antibody
KCNJ8 antibody was raised using the middle region of KCNJ8 corresponding to a region with amino acids EKPSILIQTLQKSELSHQNSLRKRNSMRRNNSMRRNNSIRRNNSSLMVPKHDAC6 antibody
The HDAC6 antibody is a highly effective medicament that targets adipose tissues and adipocytes. This monoclonal antibody specifically binds to glial fibrillary acidic protein, neutralizing its receptor binding capabilities. By doing so, it prevents the activation of reactive fatty acids and inhibits the formation of activated adipocytes. Additionally, this antibody has shown promising results in reducing glial fibrillary acidic protein levels in various life science studies. With its anti-glial fibrillary properties, the HDAC6 antibody holds great potential in the field of adipose research and therapeutic applications.CYP17A1 antibody
The CYP17A1 antibody is a highly specialized monoclonal antibody that targets the CYP17A1 enzyme. This enzyme plays a crucial role in the biosynthesis of fatty acids and lipoprotein lipase, making it an important target for therapeutic interventions. The CYP17A1 antibody has been extensively studied in various research fields, including Life Sciences, where it has shown promising results as a potential growth factor inhibitor.
CDX2 antibody
The CDX2 antibody is a polyclonal antibody that is commonly used in Life Sciences research. It is highly specific and has been extensively validated for various applications. This antibody targets the CDX2 protein, which plays a crucial role in regulating gene expression and cell differentiation.CYB5D1 antibody
CYB5D1 antibody was raised using the middle region of CYB5D1 corresponding to a region with amino acids KYEGKNLNMDFTLEENGIRDEEEEFDYLSMDGTLHTPAILLYFNDDLTELWIPI1 antibody
WIPI1 antibody was raised using the N terminal of WIPI1 corresponding to a region with amino acids AGYKLFSLSSVEQLDQVHGSNEIPDVYIVERLFSSSLVVVVSHTKPRQMN
RRAGC antibody
RRAGC antibody was raised in mouse using recombinant Human Ras-Related Gtp Binding C (Rragc)HSP27 antibody
The HSP27 antibody is a highly specific monoclonal antibody that targets the HSP27 protein, which plays a crucial role in various cellular processes. This antibody has been extensively studied and shown to be effective in detecting HSP27 in different biological samples, including human serum and tissue sections.
