Primary Antibodies

Rabbit polyclonal GPR150 antibody

Rabbit polyclonal CD71 antibody (Ser24)

HBsAg antibody (HRP) was raised in rabbit using subtypes ad & ay as the immunogen.

Purified Polyclonal RAB26 antibody

DIRAS2 antibody was raised in Rabbit using Human DIRAS2 as the immunogen

The G16 antibody is a highly specialized antibody that targets glycoproteins and acts as an anti-connexin agent. This monoclonal antibody is widely used in Life Sciences research, particularly in studies involving estrogen receptors. It has been proven to effectively prevent denaturation of these receptors and inhibit their biochemical activity. Additionally, the G16 antibody can be used for hormone peptide recombination and has shown neutralizing properties against certain hormones. Its glycopeptide structure makes it highly specific and effective in various applications, including neuroprotective research.

VEGF antibody (biotin) was raised in rabbit using highly pure recombinant murine VEGF as the immunogen.

Rabbit polyclonal CCL22 antibody (HRP)

Rabbit polyclonal Calmodulin antibody (FITC)

The Survivin antibody is a colloidal polyclonal antibody that is used in the field of Life Sciences. It acts as an inhibitor of tumor necrosis factor-alpha (TNF-α) and plays a crucial role in regulating cell division and apoptosis. This antibody specifically targets survivin, a protein that belongs to the inhibitor of apoptosis (IAP) family. By neutralizing survivin, this antibody prevents its interaction with other proteins involved in cell survival and growth, such as hepatocyte growth factor and epidermal growth factor. Additionally, the Survivin antibody has been shown to have cytotoxic effects on cancer cells by inhibiting their proliferation and inducing cell death. This makes it a valuable tool for researchers studying various diseases and exploring potential therapeutic strategies.

The CSP antibody is a highly specialized antibody that targets collagen, a protein found in various tissues of the body. It is particularly effective against Mycoplasma genitalium, a bacterium that causes infections in the genital tract. This polyclonal antibody has chemokine-like properties, meaning it can attract immune cells to the site of infection and enhance their response. Additionally, it has neutralizing abilities against certain growth factors such as TGF-beta and TNF-α, which are involved in inflammation and tissue remodeling. The CSP antibody can also bind to epidermal growth factor (EGF) and disrupt its interaction with its receptor, thus inhibiting cell proliferation. This makes it a valuable tool in research and therapeutic applications targeting diseases involving abnormal collagen metabolism or excessive growth factor signaling pathways.

Rabbit polyclonal NCF4 antibody (Thr154)

Mouse monoclonal SSSCA1 antibody

Rabbit polyclonal FOXO4 antibody (Thr451)

The CD80 antibody is a powerful tool in the field of Life Sciences. It is an antibody that specifically targets CD80, a protein involved in immune responses and cell signaling. This antibody can be used in various applications such as immunohistochemistry, flow cytometry, and Western blotting.

Rat pan granulocytes antibody was raised in mouse using peritoneal cells as the immunogen.

The TIMP1 antibody is a cytotoxic protein that plays a crucial role in various Life Sciences applications. It is a growth factor that regulates cell proliferation and differentiation. The TIMP1 antibody is widely used in chromatographic techniques, as well as in the development of monoclonal antibodies. It specifically targets hepatocyte growth factor, epidermal growth factor, collagen, and other binding proteins. This antibody is available in both monoclonal and polyclonal forms, providing researchers with options for their specific experimental needs. With its high specificity and affinity, the TIMP1 antibody is an invaluable tool for studying cellular processes and identifying potential therapeutic targets.

The TRPC1 antibody is a highly specialized polyclonal antibody that specifically targets and binds to the TRPC1 protein. This monoclonal antibody is designed to detect and measure the expression levels of TRPC1 in various biological samples. TRPC1 is a cation channel that plays a crucial role in numerous physiological processes, including hormone peptide signaling, growth factor regulation, and adipose tissue function. By utilizing this antibody, researchers in the field of Life Sciences can gain valuable insights into the activation and regulation of TRPC1 channels.

Mouse monoclonal PRKD2 antibody

Rabbit polyclonal PPP6C antibody

CARF antibody was raised using the C terminal Of Carf corresponding to a region with amino acids AIEALKATLDVFFVPLKELADLPQNKSSQESIVCELRCKSVYLGTGCGKS

TK2 antibody was raised in rabbit using the C terminal of TK2 as the immunogen

Mouse monoclonal NEK9 antibody

The PPM1B antibody is a highly specialized monoclonal antibody that has been developed for use in Life Sciences research. It specifically targets and neutralizes the PPM1B protein, which is involved in various cellular processes such as fibrinogen metabolism, helicobacter infection, and peptide nucleic acid synthesis. This antibody has been extensively tested and proven to be highly effective in blocking the activity of PPM1B, making it an essential tool for researchers studying the role of this protein in various biological systems.

Rabbit Polyclonal GDF7 antibody

Mouse monoclonal CD5 antibody (allophycocyanin)

NDRG1 antibody was raised using the N terminal of NDRG1 corresponding to a region with amino acids MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Rabbit polyclonal CCT6A antibody

GLRX5 antibody was raised using the middle region of GLRX5 corresponding to a region with amino acids NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

ACADS antibody was raised in Rabbit using Human ACADS as the immunogen

Rabbit Polyclonal Histone H3.1 antibody (Ser28)

Mouse monoclonal NECAB1 antibody

Donkey anti-mouse IgG (H + L) (Fab'2) (PE) was raised in donkey using mouse IgG (H&L) as the immunogen.

The Beta actin antibody is a powerful tool used in the field of Life Sciences for various applications. It specifically targets actin, an essential protein involved in cellular processes such as cell motility, structure, and signaling. This antibody is widely utilized in immunohistochemistry studies to visualize actin distribution and localization within tissues.

The Smad2 antibody is a highly specialized protein that targets elastase, an enzyme involved in various biological processes. This antibody is available in both polyclonal and monoclonal forms, providing researchers with a range of options for their experiments. It has been extensively used in studies related to hemoglobin and fibrinogen, as well as in assays focusing on alpha-synuclein and natriuretic peptides. The Smad2 antibody has also proven useful in the field of cytotoxicity research, particularly in investigations into myostatin and its effects on muscle growth. With its wide range of applications in life sciences, this antibody is an essential tool for researchers looking to explore the intricacies of cellular signaling pathways and protein interactions.

FUNDC1 antibody was raised using the N terminal of FUNDC1 corresponding to a region with amino acids MATRNPPPQDYESDDDSYEVLDLTEYARRHQWWNRVFGHSSGPMVEKYSV

HEMGN antibody was raised in Rabbit using Human HEMGN as the immunogen

Purified Polyclonal IKK gamma antibody

The PKMYT1 antibody is a monoclonal antibody that is used for immunohistochemical detection. It specifically targets the PKMYT1 antigen, which is an oncogene homolog involved in regulating cell cycle progression. This antibody is widely used in the field of Life Sciences for research purposes and has potential clinical applications as well. It can be used to study the expression and localization of PKMYT1 in various tissues and cell types. Additionally, this antibody can be utilized as a tool for developing novel inhibitors or therapeutic strategies targeting the protein kinase activity of PKMYT1. Its high specificity and sensitivity make it an essential component in immunohistochemistry experiments and other related studies.

Rabbit polyclonal RPL8 antibody (biotin)

PAF1 antibody was raised in rabbit using the N terminal of PAF1 as the immunogen

SPATC1 antibody was raised using the middle region of SPATC1 corresponding to a region with amino acids QSSPLIAPVMGTVAVSLSSPLLSSTATPPGVSQNLLANPMSNLVLPEAPR

The NFAT3 antibody is a highly specialized monoclonal antibody that has cytotoxic and antiangiogenic properties. It is designed to target and immobilize specific growth factors in order to inhibit their activity. This antibody has been shown to induce lysis of targeted cells, making it a valuable tool in various research fields such as life sciences and immunology. Additionally, the NFAT3 antibody can be used in conjunction with other antibodies, such as polyclonal antibodies or anti-dnp antibodies, for enhanced specificity and efficacy. Its effectiveness has been demonstrated in both in vitro and in vivo studies, making it a promising candidate for future therapeutic applications.

PCBP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids CSDAVGYPHATHDLEGPPLDAYSIQGQHTISPLDLAKLNQVARQQSHFAM