Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
CD3d antibody
CD3d antibody is a proteolytic antibody that specifically targets CD3d, a surface glycoprotein found on T cells. This antibody plays a crucial role in molecular signaling and activation of T cells, which are important components of the immune system. CD3d antibody has been extensively studied in the field of life sciences and has shown promising results in various applications.QRSL1 antibody
QRSL1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EFIKEDNRTRSAQDDIFTQAVNMAGLPAVSIPVALSNQGLPIGLQFIGRAAspartoacylase antibody
The Aspartoacylase antibody is a powerful tool used in biomedical research and diagnostics. It is commonly used to detect the presence of aspartoacylase, an enzyme found in blood plasma. This antibody can be utilized in various applications, including DNA vaccines and adeno-associated viral (AAV) vectors.
Resistin antibody (biotin)
Resistin antibody (biotin) was raised in goat using highly pure recombinant human resistinas the immunogen.LARP1 antibody
LARP1 antibody was raised using the N terminal of LARP1 corresponding to a region with amino acids KGEPGPNDVRGGEPDGSARRPRPPCAKPHKEGTGQQERESPRPLQLPGAEIL8 antibody
The IL8 antibody is a polyclonal antibody used in the field of life sciences. It specifically targets alpha-fetoprotein and is known for its neutralizing properties. This antibody is commonly used in research and diagnostic applications. It has been extensively studied and proven to be effective in blocking the activity of TGF-beta, a growth factor involved in various cellular processes. The IL8 antibody is available as a monoclonal antibody and contains excipients to ensure stability and effectiveness. It can be used for various applications, including immunohistochemistry, western blotting, and flow cytometry. This antibody is highly specific to its target molecule and has been validated for its accuracy and reliability. Researchers rely on the IL8 antibody to study the role of alpha-fetoprotein in different biological systems and to develop potential therapeutic interventions. With its high affinity and specificity, this monoclonal antibody is an essential tool for studying cell signaling pathways, drug discovery, and understanding disease mechanisms.
Factor XII antibody (HRP)
Factor XII antibody (HRP) was raised in goat using human Factor XII purified from plasma as the immunogen.
TRIM24 antibody
The TRIM24 antibody is a highly effective neutralizing agent that targets actin filaments and fibrinogen in Life Sciences research. It is commonly used in immunoassays to detect and quantify specific proteins of interest. This monoclonal antibody, derived from colloidal gold particles, exhibits high specificity and sensitivity in detecting target molecules. It can be used for various applications including Western blotting, ELISA, immunohistochemistry, and flow cytometry. The TRIM24 antibody has been extensively validated and proven to provide reliable results in research experiments. Its unique properties make it an essential tool for scientists studying protein interactions, signal transduction pathways, and cellular processes. With its exceptional performance, this antibody offers researchers the opportunity to gain valuable insights into the molecular mechanisms underlying various diseases and biological phenomena.
ASK1 antibody
The ASK1 antibody is an effective anti-HER2 antibody that can be used in various applications within the field of Life Sciences. It is available in both polyclonal and monoclonal forms, offering flexibility for different research needs. This antibody specifically targets HER2, a protein that plays a crucial role in cell growth and division.MGC33926 antibody
MGC33926 antibody was raised using the middle region of Mgc33926 corresponding to a region with amino acids RLRNIPFNLTKTIQQDEWHLLHLRRITAGFLGMAVAVLLCGCIVATVSFFSATB1 antibody
The SATB1 antibody is a glycopeptide that acts as an anti-VEGF (vascular endothelial growth factor) agent. It specifically targets the nuclear protein SATB1, which plays a crucial role in regulating gene expression and chromatin organization. This antibody has been extensively studied in the field of life sciences and has shown promising results in inhibiting tumor growth and metastasis. Additionally, it has been found to modulate various signaling pathways, including those involved in adiponectin glycosylation, fas-mediated apoptosis, human chorionic gonadotropin production, and tyrosine kinase activity. The SATB1 antibody is a highly specific monoclonal antibody that can be used for both research purposes and potential therapeutic applications. Its effectiveness and versatility make it an invaluable tool for scientists and researchers in various fields of study.CLIC5 antibody
CLIC5 antibody was raised using the C terminal of CLIC5 corresponding to a region with amino acids YRNYDIPAEMTGLWRYLKNAYARDEFTNTCAADSEIELAYADVAKRLSRSE. coli O157 antibody
E. coli O157 antibody was raised in mouse using 'O' antigen of E. coli serotype O157 as the immunogen.TFRC antibody
The TFRC antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically targets the transferrin receptor (TFRC), a protein involved in the transport of iron into cells. This antibody can be used to study various aspects of cell biology and molecular processes.Keratin K5 antibody
Keratin K5 antibody was raised in Mouse using a purified recombinant fragment of CK5 expressed in E. coli as the immunogen.LARP4 antibody
LARP4 antibody was raised using the middle region of LARP4 corresponding to a region with amino acids VSPTKNEDNGAPENSVEKPHEKPEARASKDYSGFRGNIIPRGAAGKIREQNOG antibody
The NOG antibody is a monoclonal antibody that has various characteristics and applications in the field of Life Sciences. It is known for its chemokine, cytotoxic, and growth factor properties. The NOG antibody specifically targets epidermal growth factor (EGF) and has been shown to neutralize its activity.Nucleolin antibody
Nucleolin antibody was raised using the C terminal of NCL corresponding to a region with amino acids GGFGGRGGGRGGRGGFGGRGRGGFGGRGGFRGGRGGGGDHKPQGKKTKFEPBX1 antibody
The PBX1 antibody is a nuclear monoclonal antibody that specifically targets the PBX1 protein. This protein plays a crucial role in various cellular processes, including collagen synthesis and 6-phosphogluconate dehydrogenase activity. The PBX1 antibody is widely used in the field of Life Sciences for research purposes, such as studying protein-protein interactions and signaling pathways.
TAF15 antibody
TAF15 antibody was raised using a synthetic peptide corresponding to a region with amino acids HQGSYDEQSNYDQQHDSYSQNQQSYHSQRENYSHHTQDDRRDVSRYGEDNPSMD12 antibody
PSMD12 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADGGSERADGRIVKMEVDYSATVDQRLPECAKLAKEGRLQEVIETLLSLNP antibody
The NP antibody is a highly specific and sensitive immunoassay tool used in Life Sciences research. It is a Polyclonal Antibody that targets the endothelial growth factor NP, neutralizing its activity. This antibody has been widely used in studies related to collagen and fibronectin immobilization, as well as for detecting the presence of NP in human serum samples. The NP antibody is produced using a combination of monoclonal antibodies, ensuring high specificity and accuracy in experimental results. It is an essential tool for researchers working on understanding the role of NP in various biological processes. With its reliable performance and consistent results, the NP antibody is trusted by scientists worldwide.C21ORF13 antibody
C21ORF13 antibody was raised using the N terminal Of C21Orf13 corresponding to a region with amino acids SLADLTKTNIDEHFFGVALENNRRSAACKRSPGTGDFSRNSNASNKSVDYAML1 antibody
The AML1 antibody is a neutralizing insulin antibody that targets the growth factor adalimumab. It is a monoclonal antibody that specifically binds to glutamate and has been extensively studied in the field of Life Sciences. This antibody is commonly used in research for its ability to detect and measure various proteins, including rubisco, insulin, TNF-α, natriuretic peptides, and glycoproteins. With its high specificity and sensitivity, the AML1 antibody is an essential tool for scientists conducting experiments related to protein analysis and characterization.
