Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
hCG Beta antibody
The hCG Beta antibody is a highly specific monoclonal antibody that targets the beta subunit of human chorionic gonadotropin (hCG). It is widely used in Life Sciences research for various applications, including immunoassays and immunohistochemistry.AMOTL1 antibody
AMOTL1 antibody was raised using the N terminal of AMOTL1 corresponding to a region with amino acids LTQEDPQMVYQSARQEPQGQEHQVDNTVMEKQVRSTQPQQNNEELPTYEEYTHDF1 antibody
YTHDF1 antibody was raised using the middle region of YTHDF1 corresponding to a region with amino acids QQAPSPQAAPQPQQVAQPLPAQPPALAQPQYQSPQQPPQTRWVAPRNRNAASB7 antibody
ASB7 antibody was raised using the middle region of ASB7 corresponding to a region with amino acids QTPLHLSALRDDVLCARMLYNYGADTNTRNYEGQTPLAVSISISGSSRPCSynaptojanin 2 antibody
Synaptojanin 2 antibody was raised using the N terminal of SYNJ2 corresponding to a region with amino acids SGGTSLSFLVLVTGCTSVGRIPDAEIYKITATDFYPLQEEAKEEERLIALDLX5 antibody
The DLX5 antibody is a growth factor that has antiviral properties. It is commonly used in Life Sciences research as an inhibitor for various applications. This polyclonal antibody is highly specific and can be used for the detection of proteins such as CD33 and mesothelin. The DLX5 antibody has been extensively tested and validated, ensuring reliable results in experiments. It exhibits excellent performance in various assays, including immunohistochemistry, Western blotting, ELISA, and flow cytometry. The high affinity of this antibody allows for efficient binding to its target, making it a valuable tool for researchers studying different biological processes. Additionally, the DLX5 antibody is compatible with different sample types, including human serum and tissues. Its neutralizing properties make it ideal for blocking specific interactions or pathways during experiments. With its versatile applications and reliable performance, the DLX5 antibody is an essential component in many scientific studies within the field of Life Sciences.GCHFR antibody
GCHFR antibody was raised using the N terminal of GCHFR corresponding to a region with amino acids MPYLLISTQIRMEVGPTMVGDEQSDPELMQHLGASKRRALGNNFYEYYVDFLJ33790 antibody
FLJ33790 antibody was raised using the N terminal of FLJ33790 corresponding to a region with amino acids RPRRFMDLAEVIVVIGGCDRKGLLKLPFADAYHPESQRWTPLPSLPGYTR
TRIM23 antibody
The TRIM23 antibody is a powerful diagnostic tool used in the field of Life Sciences. It is a monoclonal antibody that specifically binds to peptide sequences associated with TRIM23, a protein involved in various cellular processes. This antibody can be utilized for the detection and analysis of TRIM23 in different biological samples, including human serum and amyloid plaques. Its high specificity and sensitivity make it an excellent choice for research and diagnostic applications. The TRIM23 antibody can be used in techniques such as hybridization, immunohistochemistry, and Western blotting. Whether you are studying pluripotent stem cells or investigating the IL-1 receptor pathway, this antibody is an essential tool for your experiments. With its reliable performance and compatibility with various experimental conditions, the TRIM23 antibody is a must-have for any researcher in the Life Sciences field.FBXO9 antibody
FBXO9 antibody was raised using the middle region of FBXO9 corresponding to a region with amino acids PELESSQIHISVLPMEVLMYIFRWVVSSDLDLRSLEQLSLVCRGFYICARPKM2 antibody
The PKM2 antibody is a highly specialized antibody that is used in various applications within the field of Life Sciences. It is commonly used in research and diagnostic settings to detect and quantify the presence of PKM2, a key enzyme involved in glycolysis.α Actinin 2 antibody
alpha Actinin 2 antibody was raised using the N terminal of ACTN2 corresponding to a region with amino acids NQIEPGVQYNYVYDEDEYMIQEEEWDRDLLLDPAWEKQQRKTFTAWCNSHTD1 antibody
TD1 antibody was raised using the middle region of TD1 corresponding to a region with amino acids PPHPLNKQKHHPPHPSQTQKDLVPRSPQLEKSRIRLRRTLRNLGGGRGQRTHAP5 antibody
THAP5 antibody was raised using the middle region of THAP5 corresponding to a region with amino acids TTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSNSMEIKSAQENPF
PDLIM2 antibody
The PDLIM2 antibody is a highly specialized monoclonal antibody that targets the phosphatase PDLIM2. It has been extensively studied for its therapeutic potential in various fields of medicine, including ketamine-induced neurotoxicity and lipoprotein lipase activation. This antibody is widely used in Life Sciences research to study the role of PDLIM2 in various cellular processes, such as epidermal growth factor signaling, histidine metabolism, growth factor regulation, chemokine production, fibrinogen binding, and TGF-beta signaling. The cytotoxic properties of this antibody make it a valuable tool for investigating the functions of PDLIM2 in different biological contexts.A1CF antibody
A1CF antibody was raised using the N terminal of A1CF corresponding to a region with amino acids EAVCLGTCPEPEASMSTAIPGLKKGNNALQSIILQTLLEKENGQRKYGGPmGLUR2 antibody
The mGLUR2 antibody is a monoclonal antibody that specifically targets the metabotropic glutamate receptor 2 (mGLUR2). This receptor plays a crucial role in various physiological and pathological processes, including neuronal signaling, synaptic plasticity, and neurodegenerative diseases. The mGLUR2 antibody binds to the receptor and modulates its activity, leading to changes in cellular responses.IL18 antibody
The IL18 antibody is a reactive antibody that targets the glial fibrillary acidic protein (GFAP), which is expressed in activated glial cells. This antibody has been widely used in life sciences research to study the role of GFAP in various cellular processes. It has also been used as a diagnostic tool for detecting GFAP expression in tissues, such as brain sections with amyloid plaques. The IL18 antibody is available as a polyclonal antibody and can be used in various applications, including immunohistochemistry, western blotting, and ELISA. It offers high specificity and sensitivity, making it an ideal choice for researchers studying GFAP-related pathways or diseases.Patched antibody
The Patched antibody is a highly effective monoclonal antibody used in the field of Life Sciences. It acts as an agent and/or biocompatible polymer, which can be activated through disulfide bond formation. The nucleophilic linker group allows for the attachment of various molecules or compounds for targeted delivery. This antibody specifically targets the anti-ICOS antibodies, a human protein involved in immune regulation. The Patched antibody has high bioavailability and can be used to develop anti-idiotypic antibodies or reactive monoclonal antibodies. Additionally, it has shown affinity towards annexin A2, further expanding its potential applications in research and therapeutic settings.
C14ORF172 antibody
C14ORF172 antibody was raised using the N terminal Of C14Orf172 corresponding to a region with amino acids MSFVAYEELIKEGDTAILSLGHGAMVAVRVQRGAQTQTRHGVLRHSVDLIInterdigitating Cell antibody (Rat)
Interdigitating cell antibody was raised in mouse using rat peritoneal macrophages as the immunogen.Mouse anti Human IgG (Fc Specific) antibody
Mouse anti Human IgG (Fc Specific) antibody was raised in Mouse using purified fusion protein with human IgG(Fc Specific) tag as the immunogen.
