Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Show 1 more subcategories
Found 75602 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
53BP1 antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug that falls under the category of rifamycins. It is highly effective in treating tuberculosis infections as it contains active compounds with bactericidal activity. Through its mechanism of action, this drug inhibits bacterial growth by binding to DNA-dependent RNA polymerase, preventing transcription and replication. Extensive research has confirmed its efficacy through various techniques like transcription-quantitative polymerase chain and patch-clamp technique. The drug undergoes several metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed in Mycobacterium tuberculosis strains and inhibits cell growth. With its impressive properties and proven effectiveness, the 6-Fluoro-3-indoxyl-beta-DRFPL2 antibody
RFPL2 antibody was raised using the C terminal of RFPL2 corresponding to a region with amino acids VSFFDAESGSHVYTFRSVSAEEPLRPFLAPSVPPNGDQGVLSICPLMNSGSREBF1 antibody
SREBF1 antibody was raised in rabbit using the middle region of SREBF1 as the immunogen
NPM antibody
Nucleolar Protein NO38 antibody was raised in mouse using Nucleolar fraction prepared from Xenopus laevis oocytes as the immunogen.POLR3GL antibody
POLR3GL antibody was raised in rabbit using the C terminal of POLR3GL as the immunogenPTH antibody
PTH antibody was raised in Mouse using a purified recombinant fragment of human PTH(aa1-115) expressed in E. coli as the immunogen.KAT7 antibody
The KAT7 antibody is a highly effective anti-HER2 antibody that belongs to the class of monoclonal antibodies. It can specifically target and bind to HER2 receptors, inhibiting their activity and preventing the growth of cancer cells. This antibody is widely used in the field of life sciences for various applications, including research, diagnostics, and therapeutics.SOCS3 antibody
The SOCS3 antibody is a vital tool in the field of Life Sciences. It is commonly used to study the effects of erythropoietin, an immunosuppressant and growth factor. This antibody specifically targets the suppressor of cytokine signaling 3 (SOCS3) protein, which plays a crucial role in regulating various cellular processes.CDK1 antibody
The CDK1 antibody is a highly specialized antibody that targets the cyclin-dependent kinase 1 (CDK1), an important protein involved in cell cycle regulation. This antibody specifically recognizes and binds to CDK1, inhibiting its activity and preventing cell division. It has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.KPNA2 Antibody
The KPNA2 Antibody is a highly specialized peptide mimic that targets microvessel endothelial cells. It is designed to detect and bind to autoantibodies, making it an essential tool in the field of Life Sciences. This antibody is widely used in various industrial applications, including research on non-alcoholic steatohepatitis and biochemical studies involving protein kinases.KLF11 antibody
The KLF11 antibody is a basic protein that is widely used in Life Sciences research. It is an interferon-inducible protein that plays a crucial role in regulating gene expression. The KLF11 antibody has been extensively studied and has been found to be associated with various autoimmune diseases, including the production of autoantibodies and the regulation of IFN-gamma signaling. This monoclonal antibody is a valuable tool for researchers studying the function and activity of KLF11. It can be used as a test compound to investigate the effects of KLF11 inhibitors or other antibodies on cellular processes such as intraocular viscosity, chemokine production, acetylcholine release, and growth factor signaling. With its high specificity and affinity, the KLF11 antibody provides reliable results and contributes to advancing our understanding of important biological processes.CD40L antibody
The CD40L antibody is a monoclonal antibody used in Life Sciences research. It acts as an inhibitory factor when activated and is commonly used in various assays and experiments. This antibody specifically targets CD40L, a protein involved in immune responses and cell signaling. The CD40L antibody is produced using recombinant antigen technology and purified using cellulose-based chromatography methods.
FKTN antibody
FKTN antibody was raised using the N terminal Of Fktn corresponding to a region with amino acids TAFALQYHLWKNEEGWFRIAENMGFQCLKIESKDPRLDGIDSLSGTEIPLASGR2 antibody
ASGR2 antibody was raised using the N terminal of ASGR2 corresponding to a region with amino acids LVVICVTGSQSEGHRGAQLQAELRSLKEAFSNFSSSTLTEVQAISTHGGSGPT antibody
GPT antibody was raised using a synthetic peptide corresponding to a region with amino acids FLRQVLALCVNPDLLSSPNFPDDAKKRAERILQACGGHSLGAYSVSSGIQSTAT5A antibody
The STAT5A antibody is a monoclonal antibody used in Life Sciences research. It specifically targets and neutralizes the hepatocyte growth factor, making it a valuable tool for studying its role in various biological processes. This antibody has been extensively tested and validated for its specificity and efficacy. It can be used in a variety of applications, including Western blotting, immunoprecipitation, and immunofluorescence. The STAT5A antibody is produced using high-quality materials and is free from any harmful excipients. It recognizes the protein complex formed by STAT5A and other proteins, such as collagen and fibronectin. This antibody is an essential tool for researchers studying signal transduction pathways involving STAT5A and its downstream targets. Its high affinity and low background make it ideal for detecting even low levels of STAT5A in samples.WNT5A antibody
WNT5A antibody was raised in Mouse using a purified recombinant fragment of WNT5A expressed in E. coli as the immunogen.PIAS4 antibody
The PIAS4 antibody is a highly specialized antibody that targets α-syn, an extracellular antigen involved in various growth factor signaling pathways. This antibody is part of the Polyclonal Antibodies family and is widely used in Life Sciences research. It has been shown to be effective in detecting α-syn expression and studying its role in different cellular processes.
