Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
SF4 antibody
SF4 antibody was raised using the N terminal of SF4 corresponding to a region with amino acids MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMApoA-IV antibody
ApoA-IV antibody was raised in Mouse using a purified recombinant fragment of APOA4 (aa21-396) expressed in E. coli as the immunogen.LARP7 antibody
LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYDDCLRE1C antibody
DCLRE1C antibody was raised using a synthetic peptide corresponding to a region with amino acids SSFEGQMAEYPTISIDRFDRENLRARAYFLSHCHKDHMKGLRAPTLKRRLWASF3 antibody
WASF3 antibody was raised using the N terminal of WASF3 corresponding to a region with amino acids NMKKAFKSSTVQDQQVVSKNSIPNPVADIYNQSDKPPPLNILTPYRDDKK
ATPAF1 antibody
ATPAF1 antibody was raised using the N terminal of ATPAF1 corresponding to a region with amino acids GLGLVSPAQLRVFPVRPGSGRPEGGADSSGVGAEAELQANPFYDRYRDKIMMP9 antibody
The MMP9 antibody is a powerful tool used in Life Sciences research. It is a polyclonal antibody that specifically binds to matrix metalloproteinase 9 (MMP9), an enzyme involved in extracellular matrix degradation. This antibody has been extensively validated and is highly specific, making it ideal for use in various assays.Glucagon antibody
The Glucagon antibody is a highly specialized product used in Life Sciences research. Glucagon is a hormone that plays a crucial role in regulating blood sugar levels. This antibody specifically targets glucagon and its binding proteins, allowing for precise analysis and detection of glucagon-related processes.MGC70863 antibody
MGC70863 antibody was raised using the N terminal of MGC70863 corresponding to a region with amino acids MSLTFRRPKTLRLRRQPRYPRKSTPRRNKLGHYAIIKFPLATESAVKKIETRIM2 antibody
The TRIM2 antibody is a highly specialized product in the field of Life Sciences. It is a monoclonal antibody that specifically targets and binds to TRIM2, an important protein involved in various cellular processes. This antibody has been extensively tested and validated for its high specificity and sensitivity.ARF6 antibody
The ARF6 antibody is a highly specialized monoclonal antibody that targets the protein ARF6. This protein plays a crucial role in various cellular processes, including interleukin-6 signaling and growth factor receptor trafficking. The ARF6 antibody specifically recognizes and binds to the histidine residue on ARF6, allowing for targeted inhibition of its function.DAXX antibody
The 6-Fluoro-3-indoxyl-beta-D-galactopyranoside is a powerful antituberculosis drug belonging to the rifamycin class. It is highly effective in treating tuberculosis infections due to its bactericidal activity. This compound works by binding to DNA-dependent RNA polymerase, preventing transcription and replication, thus inhibiting bacterial growth. Extensive research has been conducted using a patch-clamp technique on human erythrocytes, demonstrating its high efficacy. Moreover, this active form undergoes various metabolic transformations, including hydrolysis by esterases or glucuronidases, oxidation by cytochrome P450 enzymes, reduction by glutathione reductase, or conjugation with glucuronic acid. Additionally, it specifically targets markers expressed at high levels in Mycobacterium tuberculosis strains and inhibits cell growth in culture.
ID2 antibody
ID2 antibody was raised in mouse using recombinant Human Inhibitor Of Dna Binding 2, Dominant Negative Helix-Loop-Helix Protein (Id2)DYNC1I1 antibody
DYNC1I1 antibody was raised using the N terminal of DYNC1I1 corresponding to a region with amino acids GSQDSGDLGPLTRTLQWDTDPSVLQLQSDSELGRRLHKLGVSKVTQVDFL
SYT1 antibody
SYT1 antibody was raised in Mouse using a purified recombinant fragment of SYT1 expressed in E. coli as the immunogen.ID2 antibody
The ID2 antibody is a monoclonal antibody that has cytotoxic effects and is used in the treatment of thrombocytopenia. It specifically targets and binds to ID2, a protein involved in cell growth and differentiation. By binding to ID2, this antibody inhibits its activity and prevents abnormal cell growth. The ID2 antibody has also been shown to inhibit the production of growth factors such as collagen and superoxide, which are involved in the progression of various diseases. Additionally, this monoclonal antibody can be used as a research tool in the field of life sciences to study the role of ID2 in different cellular processes. Its potential applications include studying the effects of ID2 inhibition on epidermal growth factor signaling, chemokine production, and TNF-α-mediated inflammation. With its ability to target specific proteins and regulate their functions, the ID2 antibody is a valuable tool for researchers and has promising therapeutic potential as well.CA19-9 Antibody
The CA19-9 Antibody is a highly specific monoclonal antibody that is used in Life Sciences research. This antibody targets the CA19-9 antigen, which is a carbohydrate structure found on the surface of certain cancer cells. The CA19-9 Antibody has been extensively tested and validated for its ability to detect and bind to this target molecule with high affinity.BRAF antibody
The BRAF antibody is a monoclonal antibody that is used in the field of Life Sciences. It specifically targets and binds to the BRAF protein, which plays a crucial role in cell growth and division. This antibody has been extensively studied for its potential neuroprotective effects and its ability to inhibit the growth of cancer cells.LOX antibody
The LOX antibody is a monoclonal antibody that targets the LOX protein, which plays a crucial role in various biological processes. This antibody can be used in Life Sciences research to study the function and expression of LOX. It is designed to specifically bind to LOX and can be used in techniques such as immunohistochemistry and Western blotting.RANKL antibody
RANKL antibody was raised in mouse using highly pure recombinant human sRANK ligand as the immunogen.AP2M1 antibody
The AP2M1 antibody is a highly specialized monoclonal antibody that targets the growth factor receptor AP2M1. It is colloidal in nature and has been specifically designed to bind to chemokines and antibodies, making it an essential tool in various life sciences research applications. The AP2M1 antibody has shown significant efficacy in studies involving breast cancer cell line MCF-7, where it demonstrated its ability to inhibit fatty acid uptake and disrupt intracellular trafficking of epidermal growth factor receptors. Additionally, this monoclonal antibody has been found to have potent anti-collagen activity and can be used for targeted therapy against diseases such as rheumatoid arthritis or fibrosis. Its activation potential on mesenchymal stem cells further highlights its versatility and potential applications in regenerative medicine.
