Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,722 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,591 products)
- Metabolism Antibodies(291 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,771 products)
- Tags & Cellular Markers(34 products)
Found 75602 products of "Primary Antibodies"
GAD65 antibody
The GAD65 antibody is a multidrug growth factor that plays a crucial role in various biological processes. It is a monoclonal antibody that specifically targets and binds to GAD65, an enzyme involved in the production of insulin and glucagon. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in research related to diabetes and autoimmune disorders.
ARAF antibody
The ARAF antibody is a highly specialized monoclonal antibody that targets and neutralizes the ARAF protein. This protein plays a crucial role in cell growth and division, making it an important target for cancer therapy. The ARAF antibody binds to the ARAF protein, preventing its activation and inhibiting tumor growth.
C1R antibody
The C1R antibody is a highly specialized protein that plays a crucial role in various life sciences applications. This antibody is specifically designed to target and neutralize the activity of certain proteins, such as growth factors and autoantibodies, which are involved in various biological processes.
KCNQ2 antibody
KCNQ2 antibody was raised using the middle region of KCNQ2 corresponding to a region with amino acids GNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYI
ZO1 antibody
The ZO1 antibody is a highly effective monoclonal antibody that specifically targets CD33, a cell surface protein. This antibody is widely used in the field of life sciences for various applications. It has been shown to inhibit the growth of cancer cells, such as MCF-7 breast cancer cells, by blocking the action of growth factors and interfering with cell signaling pathways. Additionally, the ZO1 antibody has been used in research involving mesenchymal stem cells to study their differentiation potential and therapeutic applications. Furthermore, this antibody can be utilized in immunohistochemistry and western blotting assays to detect and quantify specific proteins of interest. With its exceptional specificity and sensitivity, the ZO1 antibody is an invaluable tool for scientists and researchers in their quest for new discoveries in the field of molecular biology.
Prolactin Receptor antibody
The Prolactin Receptor antibody is a growth factor that belongs to the class of monoclonal antibodies. It has neutralizing properties and can effectively inhibit the activity of prolactin, a hormone involved in lactation and reproductive functions. This antibody has been extensively studied in the field of Life Sciences and has shown promising results in various research applications.
IBSP antibody
IBSP antibody was raised using a synthetic peptide corresponding to a region with amino acids SATTLGYGEDATPGTGYTGLAAIQLPKKAGDITNKATKEKESDEEEEEEE
N Cadherin antibody
The N Cadherin antibody is a trifunctional antibody that has various applications in the field of Life Sciences. It can be used for research purposes, such as studying growth factors and their interactions with human serum. This antibody is commonly used in laboratory settings and can be used in experiments involving electrodes and other scientific equipment.
K2 antibody
The K2 antibody is a highly effective nucleotide molecule that targets alpha-synuclein, a protein associated with neurodegenerative diseases such as Parkinson's and Alzheimer's. This anti-her2 antibody-drug conjugate specifically binds to the HER2 receptor, which is overexpressed in certain types of cancer cells. It works by inhibiting the epidermal growth factor signaling pathway, preventing the growth and proliferation of cancer cells.
RG9MTD2 antibody
RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
BRAF antibody
BRAF antibody was raised in Mouse using a purified recombinant fragment of BRAF expressed in E. coli as the immunogen.Collagen Type II antibody
Collagen type II antibody was raised in mouse using purified preparation of lathritic type II collagen from embryonic chicken sternum as the immunogen.
