Primary Antibodies
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,721 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(764 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,585 products)
- Metabolism Antibodies(286 products)
- Microbiology Antibodies(741 products)
- Signal Transduction(2,765 products)
- Tags & Cellular Markers(34 products)
Found 75594 products of "Primary Antibodies"
Carboxypeptidase E antibody
Carboxypeptidase E antibody was raised using the N terminal of CPE corresponding to a region with amino acids GMRRRRRLQQEDGISFEYHRYPELREALVSVWLQCTAISRIYTVGRSFEG
Purity:Min. 95%VSV-G antibody
VSV-G antibody was raised in rabbit using VSV-G (YTDIEMNRLGK) conjugated to KLH as the immunogen.
Purity:Min. 95%RAB40A antibody
RAB40A antibody was raised using the middle region of RAB40A corresponding to a region with amino acids RPSKVLSLQDLCCRTIVSCTPVHLVDKLPLPSTLRSHLKSFSMAKGLNAR
Purity:Min. 95%CTGF antibody
CTGF antibody was raised in rabbit using highly pure recombinant human CTGF as the immunogen.
Purity:Min. 95%WWP1 antibody
WWP1 antibody was raised using the N terminal of WWP1 corresponding to a region with amino acids ATASPRSDTSNNHSGRLQLQVTVSSAKLKRKKNWFGTAIYTEVVVDGEIT
Purity:Min. 95%ZNF624 antibody
ZNF624 antibody was raised in rabbit using the middle region of ZNF624 as the immunogen
Purity:Min. 95%BRSV antibody
BRSV antibody was raised in rabbit using residues 483-488 [FPSDEFC] of the 63 kDa RSV and BRSV F protein as the immunogen.Purity:Min. 95%S100A9 antibody
S100A9 antibody was raised using the N terminal of S100A9 corresponding to a region with amino acids MTCKMSQLERNIETIINTFHQYSVKLGHPDTLNQGEFKELVRKDLQNFLKPurity:Min. 95%Abca7 antibody
Abca7 antibody was raised in rabbit using the middle region of Abca7 as the immunogenPurity:Min. 95%Snx10 antibody
Snx10 antibody was raised in rabbit using the middle region of Snx10 as the immunogenPurity:Min. 95%PPP1R3A antibody
PPP1R3A antibody was raised using a synthetic peptide corresponding to a region with amino acids MEPSEVPSQISKDNFLEVPNLSDSLCEDEEVTFQPGFSPQPSRRGSDSSEPurity:Min. 95%IGFBP4 antibody
IGFBP4 antibody was raised using the middle region of IGFBP4 corresponding to a region with amino acids RALERLAASQSRTHEDLYIIPIPNCDRNGNFHPKQCHPALDGQRGKCWCV
Purity:Min. 95%ATP7A antibody
ATP7A antibody was raised using a synthetic peptide corresponding to a region with amino acids SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGLPurity:Min. 95%TLR9 antibody
TLR9 antibody was raised using the N terminal of TLR9 corresponding to a region with amino acids VGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN
Purity:Min. 95%Syntrophin Beta 1 antibody
Syntrophin Beta 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GAGAGHPGAGGAQPPDSPAGVRTAFTDLPEQVPESISNQKRGVKVLKQELPurity:Min. 95%SGLT1 antibody
SGLT1 antibody was raised in rabbit using a 19 amino acid peptide sequence of mouse/rabbit SGLT-1 as the immunogen.Purity:Min. 95%STEAP3 antibody
STEAP3 antibody was raised using the C terminal of STEAP3 corresponding to a region with amino acids VALVLSTLHTLTYGWTRAFEESRYKFYLPPTFTLTLLVPCVVILAKALFL
Purity:Min. 95%IL6 antibody
IL6 antibody was raised in goat using highly pure recombinant human IL-6 as the immunogen.
SLC5A11 antibody
SLC5A11 antibody was raised using a synthetic peptide corresponding to a region with amino acids VGGMEGLKEKYFLALASNRSENSSCGLPREDAFHIFRDPLTSDLPWPGVL
Purity:Min. 95%ATG5 antibody
ATG5 antibody was raised using a synthetic peptide corresponding to a region with amino acids DPEDGEKKNQVMIHGIEPMLETPLQWLSEHLSYPDNFLHISIIPQPTDPurity:Min. 95%
