Primary Antibodies

CD45.2 antibody (CY5) was raised in mouse using CD45.2 as the immunogen.

MAFF antibody was raised in Rabbit using Human MAFF as the immunogen

CD11b antibody (PE) was raised in rat using C57BL/10 murine splenic T-cells and concanavalin A-activted C57BL/10 splenocytes as the immunogen.

Rat monoclonal Toll-like receptor 9 antibody (PE)

The SGSH antibody is a highly specialized antibody that targets sulfatase, an enzyme involved in the breakdown of complex molecules called glycosaminoglycans (GAGs). This antibody specifically recognizes and binds to the sulfatase nucleotide-binding site, inhibiting its activity.

HOXD13 antibody was raised in Rabbit using Human HOXD13 as the immunogen

CD3e antibody (FITC) was raised in mouse using porcine CD3e as the immunogen.

DDT antibody is an activated phosphatase that belongs to the class of monoclonal antibodies. It is used in life sciences research for various applications, including immunohistochemistry, Western blotting, and ELISA. DDT antibody specifically binds to DDT (dichlorodiphenyltrichloroethane), a synthetic insecticide that was widely used in the past but has since been banned due to its harmful effects on the environment and human health. This antibody can be used to detect and neutralize DDT in samples such as human serum or environmental samples. It has high affinity and specificity for DDT and does not cross-react with other compounds. The DDT antibody is conjugated with a fluorescent or enzymatic tag, allowing for easy detection and quantification of DDT in various assays.

Collagen type IV antibody (biotin) was raised in rabbit using collagen type IV from human and bovine placenta as the immunogen.

Mouse monoclonal CDK5 antibody (N-terminus)

Purified Rabbit polyclonal PR1b antibody

CHMP1B antibody was raised in Rabbit using Human CHMP1B as the immunogen

The LHR antibody is a high-quality polyclonal antibody that specifically targets the luteinizing hormone receptor (LHR). It is widely used in various research fields, particularly in the life sciences. This antibody is highly specific and exhibits strong binding affinity to LHR, making it an excellent tool for studying the role of LHR in different biological processes.

The LHR antibody is a polyclonal antibody used in life sciences research. It specifically targets the luteinizing hormone receptor (LHR), which plays a crucial role in reproductive processes. This antibody is commonly used to study the interaction between LHR and various ligands, such as chemokines, on the microvascular endothelium. It can also be used in antigen-antibody reactions to detect the presence of LHR in different tissues or cell types. The LHR antibody is available as both polyclonal and monoclonal antibodies, providing researchers with options for their specific experimental needs. With its high specificity and sensitivity, this antibody is an invaluable tool for investigating the function and regulation of LHR in various biological contexts.

GSTP1 antibody was raised using the N terminal of GSTP1 corresponding to a region with amino acids TVETWQEGSLKASCLYGQLPKFQDGDLTLYQSNTILRHLGRTLGLYGKDQ

The AQP2 antibody is an immobilized monoclonal antibody that specifically targets the AQP2 antigen. It is commonly used in Life Sciences research to study amyloid plaque formation and to investigate the role of AQP2 in various physiological processes. The AQP2 antibody can also be used in combination with other antibodies, such as anti-CD20 antibodies, for immunotherapy purposes. This antibody is highly specific and has been extensively validated for its efficacy and reliability. Researchers can use the AQP2 antibody in experiments involving techniques like electrode-based assays or as inhibitors to study the effects of blocking AQP2 function. Its versatility makes it a valuable tool for scientists working in various fields, including molecular biology, biochemistry, and immunology.

PAIP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids EPTFYTSDGVPFTAADPDYQEKYQELLEREDFFPDYEENGTDLSGAGDPY