Primary Antibodies

<p>hCG alpha antibody was raised in rabbit using hCG alpha as the immunogen.</p>

<p>HIV1 gp120 antibody (FITC) was raised in rabbit using full length recombinant gp120 (HIV-1) expressed in baculovirus expression system as the immunogen.</p>

<p>Goat polyclonal Human Complement factor 5 antibody</p>

<p>CKBB antibody was raised in rabbit using human CKBB from the brain as the immunogen.</p>

<p>Purified by Protein A chromatography in PBS, pH 7.4, this mouse monoclonal antibody product is complementary to native hepatitis B surface antigen (HBsAg) and is available as two clones: 1005011 and 1005021. Potential applications of this Mab are in ELISA and lateral flow assays and in the diagnosis of the Hepatitis B (HB) infection which is a necroinflammatory liver disease with the potential to cause liver cirrhosis and heptacellular carcinoma. Clone 1005021 is recommended as a capture antibody and clone 1005011 is recommended as detection antibody.<br>The term HBsAg collectively refers to the three particle forms: Dane, filamentous and spherical of the HB virus which are made up of small HBs proteins (SHBs), middle HBs proteins (MHBs) and large HBs proteins (LHBs). These HBsAg proteins envelop the viral nucleocapsid and binds to the viral core. The LHB has a pre-S1, pre-S2 and S domain, the MHB does not have this pre-S1 domain while SHBs only have the S domain. The S domains ability to form disulphide cross-linked dimers allows Dane particles of the HBsAg to interact with sulphated proteoglycans on host cells, resulting in the activation of HB infection. Furthermore residues 2-48 which make up a conserved N-terminal sequence on the pre-S1 domain allows HBsAg to bind to the Na+-Taurocholate Co-transporter Polypeptide (NTCP) on hepatocytes.</p>

<p>This mouse monoclonal antibody is complementary to the Zika envelope protein, with batches of the IgG1k immunoglobulin subclass available. It has been purified by DEAE column chromatography and is presented as a liquid in 0.015M potassium phosphate, 0.85% NaCl, pH 7.2.&lt;/p&gt; &lt;p&gt;Transmitted by infected mosquitoes, the Zika virus, although it causes asymptotic and mild symptoms in the majority of cases, it can lead to neurological complications and Guillain-Barr&amp;eacute; syndrome in adults. Furthermore during pregnancy, infants may be born with microcephaly and congenital malformations, known as Zika syndrome. The envelope protein located on the Zika viral membrane and to which this mouse Mab is complementary, is involved in virus and host cell surface receptor binding. It has 3 domains (I, II and III) and a stem-transmembrane domain. Domain I functions to link Domain III (which is the host cell receptor binding domain) to Domain II in order to dimerise and form a fusion loop.&lt;/p&gt; &lt;p&gt;The accessible location of the Envelope protein on the viral membrane means it can be an important target for neutralising antibodies and vaccine development. This product can further be used in the rapid lateral flow detection of Zika envelope protein and other antibody and antigen interaction dependent assays such as ELISA and western blot.</p>

<p>Anti-Ferritin monoclonal antibody; &gt;95% pure (SDS-PAGE)</p>

<p>A wild strain sourced Candida Albicans Antigen, consisting of cytoplasmic and cell wall components presented in an alkaline pH glycine buffer. The antigen is presented as washed harvested organisms that have been disrupted and subjected to an extraction process. The infectivity has been confirmed negative by the absence of growth under original cell culture conditions. It is important to note this product needs to be sonicated before used and repeated freezing and thawing needs to be avoided.The Candida Albicans Antigen is a part of the human fungal pathogen Candida Albicans in humans, mainly colonizing in areas of the gastrointestinal tract, vagina and cutaneous areas. The cell wall components of this antigen are home to the immunodominant antigens in candidiasis and are responsible for generating a response from the host's immune system. Proteins and the glycoproteins mannoproteins, located within this cell wall, interact with the exocellular environment. Research applications of this antigen can be in the development of immunoassays such as ELISA.</p>

<p>Rabbit polyclonal PIH1D1 antibody</p>

<p>The ROD1 antibody is a neutralizing antibody that belongs to the category of polyclonal antibodies. It is used in life sciences research to study the role of interleukins and other growth factors. This antibody specifically targets nuclear binding proteins and can be used in various assays and experiments. Whether you need a monoclonal or polyclonal version, the ROD1 antibody is an essential tool for researchers looking to study the effects of specific proteins or develop new drug antibodies. With its high specificity and reliability, this antibody is a valuable addition to any laboratory's toolkit.</p>

<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>

<p>Rabbit polyclonal APBB1IP antibody</p>

<p>Rabbit polyclonal ZNHIT1 antibody</p>

<p>Rabbit polyclonal PPP1R15B antibody</p>

<p>Rabbit polyclonal USP28 antibody</p>

<p>Rabbit polyclonal TROAP antibody</p>

<p>C5ORF39 antibody was raised using the N terminal Of C5Orf39 corresponding to a region with amino acids EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS</p>