Primary Antibodies
Primary antibodies are immunoglobulins that bind specifically to an antigen of interest, allowing for the detection and quantification of proteins, peptides, or other biomolecules. These antibodies are critical tools in a wide range of applications, including Western blotting, immunohistochemistry, and ELISA. At CymitQuimica, we offer an extensive selection of high-quality primary antibodies that provide specificity and sensitivity for various research needs, including cancer, immunology, and cell biology studies.
Subcategories of "Primary Antibodies"
- Cancer Research Antibodies(3,609 products)
- Cardiovascular Antibodies(2 products)
- Developmental Biology(746 products)
- Epigenetics Antibodies(162 products)
- Immunology Antibodies(2,375 products)
- Metabolism Antibodies(278 products)
- Microbiology Antibodies(736 products)
- Signal Transduction(2,710 products)
- Tags & Cellular Markers(33 products)
Show 1 more subcategories
Found 75302 products of "Primary Antibodies"
Sort by
Purity (%)
0
100
|
0
|
50
|
90
|
95
|
100
CRP antibody
<p>CRP antibody was raised in mouse using human CRP derived from pleural/ascetic fluid or plasma as the immunogen.</p>MZF1 antibody
<p>The MZF1 antibody is a potent family kinase inhibitor that belongs to the class of antibodies. It specifically targets fibrinogen, a protein involved in blood clotting. This polyclonal antibody has been extensively studied and proven to be effective in inhibiting the activity of fibrinogen. It can be used in various applications in the field of Life Sciences, such as research on dopamine receptors and growth factors. Additionally, this monoclonal antibody has shown inhibitory effects on tyrosine kinases, which play a crucial role in cell signaling pathways. The MZF1 antibody is a valuable tool for scientists and researchers working in the fields of biology, medicine, and pharmacology. Its versatility and specificity make it an essential component in various experiments and studies.</p>Affinity Purified anti-Sheep IgG h+l Antibody
<p>Affinity Purified Donkey anti-Sheep IgG h+l Antibody</p>Purity:Min. 95%H+K+ ATPase antibody
<p>H, K ATPase antibody was raised in mouse using a 34kDa core peptide purified from deglycosylated hog gastric microsomes as the immunogen.</p>...C-peptide antibody
<p>The C-peptide antibody is a synthetic, recombinant protein that has been activated for use in various life sciences assays. This antibody is specifically designed to detect and bind to C-peptide, a protein fragment that is cleaved from proinsulin during insulin synthesis. The C-peptide antibody can be used in electrophoresis and other laboratory techniques to study the presence and function of C-peptide in human serum samples. This monoclonal antibody is highly specific and has been extensively characterized for its performance and reliability. It can be used as a valuable tool in research and diagnostic applications related to diabetes, insulin secretion, and related disorders. With its buffered formulation and high sensitivity, the C-peptide antibody ensures accurate and reproducible results in various experimental settings. Trust this antibody for your research needs in the field of endocrinology and beyond.</p>Carbonic Anhydrase I antibody
<p>Carbonic Anhydrase I antibody was raised using the N terminal of CA1 corresponding to a region with amino acids ASPDWGYDDKNGPEQWSKLYPIANGNNQSPVDIKTSETKHDTSLKPISVS</p>ETFB antibody
<p>ETFB antibody was raised using the C terminal of ETFB corresponding to a region with amino acids TADLRLNEPRYATLPNIMKAKKKKIEVIKPGDLGVDLTSKLSVISVEDPP</p>anti-Dengue Envelope Protein Antibody
<p>Please enquire for more information about anti-Dengue Envelope Protein Antibody including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>Purity:Min. 95%GCLC antibody
<p>GCLC antibody was raised using the N terminal of GCLC corresponding to a region with amino acids VLETLQEKGERTNPNHPTLWRPEYGSYMIEGTPGQPYGGTMSEFNTVEAN</p>
