Amino Acids (AA)

<p>Growth hormone-releasing factor (GRF) or GHRH (growth hormone-releasing hormone).Binds to the growth hormone-releasing hormone receptor (GHRH-R), causing growth hormone secretion.porcine: H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGERNQEQGARVRL-NH2bovine:  H-YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2ovine:    H-YADAIFTNSYRKILGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2human:  H-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2</p>

<p>Please enquire for more information about (3-(4-Azidophenyl)propionyl1,D-Tyr(Me)2,Arg6,Arg8,Tyr-NH29)-Vasopressin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Sar-Pro-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-b-Ala-Phe-Pro-OH is a chemical compound that is used as a reaction component, reagent, and useful scaffold. It reacts with various other chemicals to form complex compounds. This synthetic compound can be used as an intermediate in the synthesis of peptides, proteins, and other organic compounds. Fmoc-b-Ala-Phe-Pro-OH can also be used as a building block for the synthesis of speciality chemicals.</p>

<p>Please enquire for more information about Conantokin G (free acid) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about pTH (18-48) (human) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Gln-Gly-OH is a proteolytic enzyme that cleaves peptide bonds in proteins. It is an enzyme that is involved in inflammatory diseases, as it has been shown to inhibit the production of messenger RNA (mRNA) and protein synthesis. H-Gln-Gly-OH also has anti-inflammatory properties. It has been shown to inhibit the production of amines from the amino acid arginine, which may be linked to its anti-inflammatory effects. This enzyme does not have a specific role in human metabolism and is found in human liver and other tissues. The structural analysis of this enzyme reveals that it contains a carbonyl group and an amide group with acidic properties. H-Gln-Gly-OH has been implicated in autoimmune diseases and infectious diseases, as it has been found in Streptococcus pyogenes, Mycoplasma pneumoniae, Borrelia burgdorferi, Coxiella burnetii</p>

<p>H-Ala-His-OH is a dietary supplement that contains histidine and alanine. Histidine is an amino acid involved in protein synthesis, which is a process that produces proteins from amino acids. H-Ala-His-OH has shown to inhibit chemical reactions involving histidine, such as the conversion of histidine to urocanic acid by bacterial enzymes. The uptake of H-Ala-His-OH has been shown to be increased by creatine supplementation, which may be due to the ability of creatine to increase cellular energy levels. Magnetic resonance spectroscopy (MRS) analysis has shown that H-Ala-His-OH increases glutamine levels in the brain. This may be due to its ability to cross the blood brain barrier and affect glutamate transport through the blood brain barrier.</p>

<p>Please enquire for more information about (Ser(Ac)3)-Ghrelin (mouse, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-N-methylglycine is a modified form of the amino acid glycine, which has been modified to include a reactive group that can be used to link other molecules. This molecule has gram-negative bacterial activity and exhibits potent antibacterial activity against many gram-positive bacteria. Fmoc-N-methylglycine is also an antimicrobial peptide with binding constants in the nanomolar range. It is also an agent that binds to serotonin, which may explain its effects on mood and sleep. Fmoc-N-methylglycine can be synthesized using stepwise solid phase synthesis methods or by conjugation with other molecules.</p>

<p>Please enquire for more information about Spexin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Z-Gln(Mtt)-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Neuromedin N trifluoroacetate salt is a neurotrophin that regulates the growth and differentiation of nerve cells. It has been shown to increase locomotor activity in rats and to activate the receptor for neurotrophins. Neuromedin N trifluoroacetate salt also binds to response elements in DNA and can also modulate camp levels, cytosolic calcium, and protein kinase C levels in cells. This molecule has been shown to have antinociceptive properties by inhibiting the pain-causing action of substance P on sensory neurons. It is possible that this drug may be used as a growth factor or as a messenger RNA (mRNA) in fatty acid synthesis.</p>

<p>Please enquire for more information about H-Ile-Glu-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Phenylac-Leu-Asp-Phe-D-Pro-NH2 is a molecule that inhibits the inflammatory response by binding to the active site of proteinase 3. It has been shown to be effective in treating bowel disease, such as Crohn's disease, and also shows potential for use in other inflammatory diseases, including autoimmune diseases and blood disorders. Phenylac-Leu-Asp-Phe-D-Pro-NH2 is an inhibitor of proprotein convertase 3 (PC3) and has been shown to inhibit the activity of PC3 in vitro. This inhibition leads to reduced production of inflammatory cytokines and decreased inflammation in animal models. Clinical studies have demonstrated that phenylacetic acid ester derivatives are safe for use in humans.</p>

<p>Please enquire for more information about Fmoc-p-nitro-Phe-Wang resin (200-400 mesh) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Pyr-Phe-Leu-pNA is a proteolytic enzyme that is used in the production of monoclonal antibodies. The enzyme was originally isolated from human pancreas, but has also been found in other sources including eggs, bovine pancreas, and various bacteria. Pyr-Phe-Leu-pNA hydrolyzes peptide bonds with a preference for serine and threonine residues. This enzyme has been shown to be effective at cleaving influenza virus protein hemagglutinin, which may be useful in the development of new vaccines. Pyr-Phe-Leu-pNA has also been shown to have high salt tolerance, making it a good candidate for use in food processing applications.</p>

<p>Please enquire for more information about Boc-(±)-trans-4-(3-trifluoromethylphenyl)pyrrolidine-3-carboxylic acid including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Glu-Ala-OH is a human protein that belongs to the family of glycosylated proteins. It is expressed in the cells of the ovary and is a member of the insulin-like growth factor (IGF) superfamily. H-Glu-Ala-OH binds to lectins in mammalian cells, which may be due to its sulfoxide group. This protein has been shown to have dehydrogenase activity and polymerase chain reaction (PCR) amplification properties. H-Glu-Ala-OH has also been shown to inhibit growth in cell culture and promote apoptosis, which may be due to its ability to regulate IGF levels in mammalian cells.br&gt;br&gt;<br>br&gt;br&gt;<br>This protein is found at high levels in ovarian cancer cells and serum from patients with ovarian cancer. The sequence of this protein has been determined using mass spectrometry analysis on ovary extracts and on cDNA derived from human embryonic kidney (</p>

<p>Z-Gly-Pro-pNA is a synthetic substrate that has been used in the development of polyclonal antibodies against the surface protein of Stenotrophomonas maltophilia. The antibody, when immobilized to an insoluble support, was able to detect the bacterial cells within 10 hours. Z-Gly-Pro-pNA is a cyclic peptide with a proteolytic activity and an acidic pH optimum. It has been shown that Z-Gly-Pro-pNA can be hydrolysed by serine proteases such as trypsin and chymotrypsin.</p>

<p>3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is a synthetic chemical that is used as a pesticide. This chemical has been found to be more effective than other pesticides because it can inhibit the synthesis of fatty acids, which are necessary for the growth of insect larvae. 3-(Difluoromethyl)-1-methyl-1H-pyrazole-4-carboxylic acid is synthesized by reacting sodium hydroxide solution with triethyl orthoformate in the presence of hexamethylenetetramine. This reaction produces a mixture of diethyl ester and carboxylate esters, which are then separated from each other. The resulting carboxylate ester is then oxidized to produce 3-(difluoromethyl)-1-methyl-1H pyrazole 4 carboxylic acid.</p>

<p>Please enquire for more information about (Ser(tBu)6,Azagly10)-LHRH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about N-Me-Abz-Amyloid beta/A4 Protein Precursor770 (708-715)-Lys(Dnp)-D-Arg-D-Arg-D-Arg amide trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg-OH is a diacylglycerol that regulates the expression of genes and has been shown to modulate hematopoietic cells. This compound is a derivative of atypical proteins, which are proteins that have an atypical tertiary structure and do not possess a classical signal peptide or secretion signal. H-Ala-Pro-Arg-Thr-Pro-Gly-Gly-Arg-Arg -OH has been shown to be expressed in hematopoietic growth regulator domains, which may account for its pleiotropic effects on hematopoietic cells.</p>

<p>A building block used for derivatization of carboxylic acids or activated esters with methytetrazine moiety. The stability of Methyltetrazine Amine is substantially improved compared to hydrogen substituted tetrazine-tmine. Superior stability of methyltetrazine-amine allows this reagent to be used in wider range of chemical transformations. Long-term storage of methyltetrazine-amine, especially in aqueous buffer, is also greatly improved compared to Tetrazine Amine.Supplied as the HCl salt</p>

<p>Please enquire for more information about (Des-Gly10,D-Pyr 1,D-Leu6,Pro-NHEt 9)-LHRH trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuropeptide Y (13-36) (porcine) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>PAR-2 (6-1) amide is a proteolytic enzyme that is activated by inflammatory stimuli. It has been shown to be a major contributor to the pathogenesis of inflammatory bowel disease, and is found in neurons, the bowel, and pancreatic acinar cells. PAR-2 (6-1) amide activates proteases such as trypsin and chymotrypsin and also functions as an antimicrobial peptide. Activation of PAR-2 (6-1) amide leads to the cleavage of proteins at specific sites on their amino acid chains. This cleavage can lead to changes in protein conformation or function. PAR-2 (6-1) amide has been shown to increase endothelial cell proliferation and inhibit bacterial growth, but does not have any effect on cultured normal human skin fibroblasts.</p>

<p>Please enquire for more information about (D-Trp32)-Neuropeptide Y (human, rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Fmoc-D-glu(OtBu)-OH is a homologous molecule that binds to the influenza virus and inhibits its replication. The synthesis of Fmoc-D-glu(OtBu)-OH is achieved by solid-phase peptide synthesis, which involves the ligation of amino acid building blocks on an insoluble carrier resin. This process has been found to be effective for the synthesis of peptides with a variety of amino acid sequences. Fmoc-D-glu(OtBu)-OH has been shown to inhibit the growth and multiplication of Chlorella pyrenoidosa, a single celled green alga, and Paramecium tetraurelia, a protozoan ciliate. It also displays antimycobacterial activity against Mycobacterium tuberculosis in vitro.</p>

<p>2,4-Dihydroxy-5-methylbenzoic acid is a high quality chemical that can be used as a reagent, intermediate, or building block. It has many uses in the production of fine chemicals and research chemicals. 2,4-Dihydroxy-5-methylbenzoic acid is also a versatile building block for organic synthesis reactions. This compound has shown to have anti-inflammatory properties and may be useful as a treatment for arthritis.</p>

<p>H-Gly-Arg-Gly-Asp-Ser-OH TFA salt is a synthetic peptide that is designed to bind to the nuclear factor kappa B (NFκB) and inhibit its activation. NFκB is a transcription factor that regulates gene expression in response to various stimuli, including proinflammatory cytokines, oxidants, and electrophilic compounds. H-Gly-Arg-Gly-Asp-Ser-OH TFA salt has been shown to inhibit NFκB activation in a model system. This molecule also inhibits axonal growth and pluripotent cells differentiation, which may be due to its suppression of the signal peptide. The rate constant for this drug has been measured using polymer compositions and biocompatible polymers.</p>

<p>Kemptamide is a peptide that has been shown to have cytotoxic and anti-proliferative effects on renal cancer cells. It is a synthetic analogue of an endogenous peptide, Lys-Lys-Arg-Pro-Gln-Arg-Ala-Thr-Ser-Asn-Val-Phe, that is found in porcine kidney. Kemptamide’s cytotoxic activity may be due to its ability to inhibit the activity of phosphatases. Kemptamide also has regulatory properties and can modulate the expression of genes that are involved in cell growth and apoptosis. This peptide has been shown to be reactive with kidney cells, which may lead to its therapeutic effect on renal cancer.</p>

<p>Please enquire for more information about HIV-1 tat Protein (49-57) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Prion Protein (106-126) (human) (scrambled) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>H-Leu-bNA is a gene product that has been activated and is involved in the production of chronic arthritis. H-Leu-bNA is a basic protein that catalyzes the conversion of chloromethyl ketone to iodoacetic acid, which then converts neutral ph substances to acidic ph substances. This enzyme also catalyzes the conversion of amino acids to their corresponding amines and ammonia. H-Leu-bNA may be involved in autoimmune diseases with acidic phs, such as rheumatoid arthritis. It has an optimum pH of 7.4 and will not work at higher or lower pHs. The sequences for this enzyme are found in plants, but it is not found in humans or animals.br&gt;<br>H-Leu-bNA can be used as a kinetic tool to measure enzyme activity. Kinetic data for this enzyme show that it has a high affinity for chloromethyl ketone and can be inhibited by certain chemicals,</p>

<p>Z-Ala-Pro-pNA is a serine protease that cleaves peptide bonds in proteins. It has been shown to be active against a number of organisms, including Pyrococcus furiosus and Porcine pancreatic extracts, as well as specificities such as amino acid residues and oligopeptidases. Z-Ala-Pro-pNA may have uses in the food industry by acting on proteins that are found in meat products.</p>

<p>Please enquire for more information about (Des-Gly10,D-Ala6,Pro-NHEt 9)-LHRH II (chicken) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about SV40 Nuclear Transport Signal Peptide Analog including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Neuroendocrine Regulatory Peptide-1 (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Ala-D-Ala-Ala-OH including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (2R,4S)-1-tert-Butyl 2-methyl4-aminopyrrolidine-1,2-dicarboxylate including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Angiotensin I/II (1-5) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Bz-Arg-Gly-Phe-Phe-Pro-4MbetaNA·HCl including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Z-Ala-Ala-pNA is a bifunctional endopeptidase that has regulatory and subtilisin activity. It is used to regulate the production of nitrate in microorganisms such as bacteria and fungi, which can be an important factor in the production of food products. Z-Ala-Ala-pNA is a recombinant enzyme that was developed from a strain of Bacillus subtilis. This enzyme has binding sites for both serine proteinases and sodium nitrate. It degrades proteins by cleaving them at their serine residues, releasing amino acids and peptides from the N-terminus of the protein. The regulatory function of this enzyme is due to its ability to bind to nitrate ions, thereby regulating their concentration in cells.</p>

<p>Please enquire for more information about Neuromedin S (rat) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Biotinyl-Atrial Natriuretic Factor (1-28) (human) trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about Anti-Kentsin trifluoroacetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about H-Lys-Lys-Lys-Trp-Lys-Lys-Lys-OH acetate salt including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>

<p>Please enquire for more information about (Tyr0)-Atriopeptin II (rat) including the price, delivery time and more detailed product information at the technical inquiry form on this page</p>