Peptides

Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.

Oligopeptides

Peptide Synthesis

Products of "Peptides"

20
- 50
- 100
- 200

products per page. 31282 products on this category.

Product data	Purity	Price range	Estimated delivery
Parathyroid Hormone (1-34)-Lys(Biotin), human REF: 3D-VAC-00752	- - -	464.00 €~1,849.00 €	Fri 24 Jan 25
Antioxidant peptide B REF: 3D-VAC-00775	- - -	286.00 €~759.00 €	Fri 24 Jan 25
WWamide-3 REF: 3D-VAC-00821	- - -	225.00 €~626.00 €	Fri 24 Jan 25
HIV-gp41-Antigenic Peptide 5 REF: 3D-VAC-00698	- - -	461.00 €~1,837.00 €	Fri 24 Jan 25
HPV-E7-N REF: 3D-VAC-00899	- - -	252.00 €~1,003.00 €	Fri 24 Jan 25
PDGFRtide REF: 3D-VAC-00639	- - -	256.00 €~711.00 €	Fri 24 Jan 25
H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH REF: 3D-PP47266	- - -	887.00 €~2,324.00 €	Fri 24 Jan 25
MMP Substrate I, fluorogenic REF: 3D-VAC-00144	- - -	170.00 €~640.00 €	Fri 24 Jan 25
Adrenomedullin (1-52), human REF: 3D-VAC-00919	- - -	600.00 €~2,691.00 €	Fri 24 Jan 25
Fmoc-Ser(tBu)-Wang resin (100-200 mesh) REF: 3D-FF111735	Min. 95%	307.00 €~2,718.00 €	Fri 24 Jan 25
OV-2, Sheep REF: 3D-VAC-00582	- - -	155.00 €~583.00 €	Fri 24 Jan 25
Saposin C22 REF: 3D-VAC-00267	- - -	208.00 €~827.00 €	Fri 24 Jan 25
Fibronectin Analog REF: 3D-VAC-00443	- - -	194.00 €~541.00 €	Fri 24 Jan 25
α-Gliadin (57-73) REF: 3D-VAC-00647	- - -	178.00 €~669.00 €	Fri 24 Jan 25
Biotin-Pancreatic Polypeptide, human REF: 3D-VAC-00074	- - -	351.00 €~1,314.00 €	Fri 24 Jan 25
Corticotropin Releasing Factor, human, rat REF: 3D-VAC-00709	- - -	496.00 €~1,977.00 €	Fri 24 Jan 25
[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)] REF: 3D-VAC-00495	- - -	346.00 €~976.00 €	Fri 24 Jan 25
Orexin A trifluoroacetate REF: 3D-BO183537CAS: 205599-75-3	Min. 95%	172.00 €~801.00 €	Fri 24 Jan 25
Niridazole REF: 3D-AAA06157CAS: 61-57-4	Min. 95%	273.00 €~1,259.00 €	Fri 24 Jan 25
α-Endorphin REF: 3D-VAC-00885	- - -	166.00 €~626.00 €	Fri 24 Jan 25

2g		307.00 €
5g		513.00 €
10g		830.00 €
25g		1,562.00 €
50g		2,718.00 €

1mg		172.00 €
2mg		279.00 €
5mg		364.00 €
10mg		518.00 €
25mg		801.00 €

250mg		279.00 €
2500mg		1,044.00 €

Peptides

Subcategories of "Peptides"

Oligopeptides

Peptide Synthesis

Products of "Peptides"

Parathyroid Hormone (1-34)-Lys(Biotin), human

Ref: 3D-VAC-00752

Antioxidant peptide B

Ref: 3D-VAC-00775

WWamide-3

Ref: 3D-VAC-00821

HIV-gp41-Antigenic Peptide 5

Ref: 3D-VAC-00698

HPV-E7-N

Ref: 3D-VAC-00899

PDGFRtide

Ref: 3D-VAC-00639

H-MFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ-OH

Ref: 3D-PP47266

MMP Substrate I, fluorogenic

Ref: 3D-VAC-00144

Adrenomedullin (1-52), human

Ref: 3D-VAC-00919

Fmoc-Ser(tBu)-Wang resin (100-200 mesh)

Ref: 3D-FF111735

OV-2, Sheep

Ref: 3D-VAC-00582

Saposin C22

Ref: 3D-VAC-00267

Fibronectin Analog

Ref: 3D-VAC-00443

α-Gliadin (57-73)

Ref: 3D-VAC-00647

Biotin-Pancreatic Polypeptide, human

Ref: 3D-VAC-00074

Corticotropin Releasing Factor, human, rat

Ref: 3D-VAC-00709

[Leu144, Arg147]-PLP (139-151), [L144, R147-PLP(139-151)]

Ref: 3D-VAC-00495

Orexin A trifluoroacetate

Ref: 3D-BO183537

Niridazole

Ref: 3D-AAA06157

α-Endorphin

Ref: 3D-VAC-00885