Product correctly added to cart.

No image
No image

Peptides

Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.

Read more

Subcategories of "Peptides"

Products of "Peptides"

Sort by


See more categories

This search does not contain any category.

products per page. 30645 products on this category.

discount label

Trp-Ile-Arg


Ref: 3D-PP50675

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-LPDA^TPTELA^K^-OH


Ref: 3D-PP40761

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

CMVpp65 - 132 (AELEGVWQPAAQPKR)


Ref: 3D-PP50842

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-NINNN-NHMe


Ref: 3D-PP48671

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-RP^QQPYPQPQPQY-OH


Ref: 3D-PP46702

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH


Ref: 3D-PP47702

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-SDAPIGK^-OH


Ref: 3D-PP47385

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

2Azido-GRKKRRQRRRPPQ-OH


Ref: 3D-PP49662

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

Ac-RYDLGGAGMVC-NH2


Ref: 3D-PP46606

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-AATVGSLAGQPLQ^ER-OH


Ref: 3D-PP48515

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-FESNFNTQATNR^-OH


Ref: 3D-PP40709

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

(Asn(4-aminobutyl)1·7·23,Gln(4-aminobutyl)3·11·22)-Amyloid b-Protein (1-40) trifluoroacetate salt


Ref: 3D-FA109424

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

Ac-ETFG-OH


Ref: 3D-PP48618

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

CMVpp65 - 121 (VFTWPPWQAGILARN)


Ref: 3D-PP51019

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

Hemoglobin β chain [133-146]


Ref: 3D-PP50835

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

Protease-Activated Receptor-2, PAR-2 Agonist, amide


Ref: 3D-PP47968

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-LLIYGASSR^-OH


Ref: 3D-PP41213

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-FEDENFILK^-OH


Ref: 3D-PP47290

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-SA^VTALWGK^-OH


Ref: 3D-PP43401

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
discount label

H-GTPTAENPEYLGL^DVPV-OH


Ref: 3D-PP42787

Undefined sizeTo inquire
Estimated delivery in United States, on Monday 2 Dec 2024
Welcome to CymitQuimica!We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".