Peptides

Peptides are short chains of amino acids linked by peptide bonds, serving as important biological molecules that play key roles in cellular processes. They function as hormones, neurotransmitters, and signaling molecules, and are widely used in therapeutic and diagnostic applications. Peptides are also crucial in research for studying protein interactions, enzyme activities, and cell signaling pathways. At CymitQuimica, we provide a diverse selection of high-quality peptides to support your research and development needs in biotechnology and pharmaceuticals.

Read more

Subcategories of "Peptides"

Oligopeptides

Peptide Synthesis

Products of "Peptides"

20
- 50
- 100
- 200

products per page. 31282 products on this category.

Brand	Product data	Purity	Price range	Estimated delivery
	H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH REF: 3D-PP47702	- - -	To inquire	Tue 10 Dec 24
	H-SDAPIGK^-OH REF: 3D-PP47385	- - -	To inquire	Tue 10 Dec 24
	H-FESNFNTQATNR^-OH REF: 3D-PP40709	- - -	To inquire	Tue 10 Dec 24
	Ac-ETFG-OH REF: 3D-PP48618	- - -	To inquire	Tue 10 Dec 24
	H-NSSFNPAALSR^-OH REF: 3D-PP41329	- - -	To inquire	Tue 10 Dec 24
	H-ASLFSFK^-OH REF: 3D-PP46544	- - -	To inquire	Tue 10 Dec 24
	H-WRQAAFVDSY-NH2 REF: 3D-PP42785	- - -	To inquire	Tue 10 Dec 24
	Melanotan I REF: 3D-PP50536CAS: 75921-69-6	- - -	To inquire	Tue 10 Dec 24
	H-ALPAPIEKTISK-NH2 REF: 3D-PP41462	- - -	To inquire	Tue 10 Dec 24
	H-FESSAAKLKRKYWWKNLK^-OH REF: 3D-PP48672	- - -	To inquire	Tue 10 Dec 24
	Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2 REF: 3D-PP45664	- - -	To inquire	Tue 10 Dec 24
	Ac-PLL-OH REF: 3D-PP43785	- - -	To inquire	Tue 10 Dec 24
	H-NGFYPATR^-OH REF: 3D-PP41115	- - -	To inquire	Tue 10 Dec 24
	Biot-ARARARAR-OH REF: 3D-PP43837	- - -	To inquire	Tue 10 Dec 24
	H-LSTSEIASHLPTK^^-OH REF: 3D-PP43956	- - -	To inquire	Tue 10 Dec 24
	H-EKAHDGGR^YYRA-OH REF: 3D-PP40243	- - -	To inquire	Tue 10 Dec 24
	5Fam-DRVYIHPF-OH REF: 3D-PP44223	- - -	To inquire	Tue 10 Dec 24
	H-KIVL-NH2 REF: 3D-PP48044	- - -	To inquire	Tue 10 Dec 24
	H-HQFLLTGDTQGR^-OH REF: 3D-PP40725	- - -	To inquire	Tue 10 Dec 24
	H-TEGLQEALLK^^-OH REF: 3D-PP44145	- - -	To inquire	Tue 10 Dec 24

discount label

H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH

H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH

Peptide H-SIPPEVKFNKPFVFLMIEQNTKSPLFMGKVVNPTQK^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP47702

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-SDAPIGK^-OH

Peptide H-SDAPIGK^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP47385

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-FESNFNTQATNR^-OH

H-FESNFNTQATNR^-OH

Peptide H-FESNFNTQATNR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP40709

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

Ac-ETFG-OH

Peptide Ac-ETFG-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP48618

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-NSSFNPAALSR^-OH

H-NSSFNPAALSR^-OH

Peptide H-NSSFNPAALSR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP41329

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-ASLFSFK^-OH

Peptide H-ASLFSFK^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP46544

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-WRQAAFVDSY-NH2

H-WRQAAFVDSY-NH2

Peptide H-WRQAAFVDSY-NH2 is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP42785

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

Melanotan I

Custom research peptide; min purity 95%. For different specs please use the Peptide Quote Tool

Formula:

C₇₈H₁₁₁N₂₁O₁₉

Molecular weight:

1,646.9 g/mol

Ref: 3D-PP50536

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-ALPAPIEKTISK-NH2

H-ALPAPIEKTISK-NH2

Peptide H-ALPAPIEKTISK-NH2 is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP41462

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-FESSAAKLKRKYWWKNLK^-OH

H-FESSAAKLKRKYWWKNLK^-OH

Peptide H-FESSAAKLKRKYWWKNLK^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP48672

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2

Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2

Peptide Ac-FAKKFAKKFKKFAKKFAKFAFAF-NH2 is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP45664

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

Ac-PLL-OH

Peptide Ac-PLL-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP43785

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-NGFYPATR^-OH

Peptide H-NGFYPATR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP41115

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

Biot-ARARARAR-OH

Biot-ARARARAR-OH

Peptide Biot-ARARARAR-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP43837

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-LSTSEIASHLPTK^^-OH

H-LSTSEIASHLPTK^^-OH

Peptide H-LSTSEIASHLPTK^^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP43956

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-EKAHDGGR^YYRA-OH

H-EKAHDGGR^YYRA-OH

Peptide H-EKAHDGGR^YYRA-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP40243

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

5Fam-DRVYIHPF-OH

5Fam-DRVYIHPF-OH

Peptide 5Fam-DRVYIHPF-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP44223

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-KIVL-NH2

Peptide H-KIVL-NH2 is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP48044

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-HQFLLTGDTQGR^-OH

H-HQFLLTGDTQGR^-OH

Peptide H-HQFLLTGDTQGR^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP40725

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

discount label

H-TEGLQEALLK^^-OH

H-TEGLQEALLK^^-OH

Peptide H-TEGLQEALLK^^-OH is a Research Peptide with significant interest within the field academic and medical …

Ref: 3D-PP44145

Undefined size To inquire

Estimated delivery in United States, on Tuesday 10 Dec 2024

Welcome to CymitQuimica!

We use cookies to enhance your visit. We do not include advertising.

Please see our Cookies Policy for more details or adjust your preferences in "Settings".

SettingsHide settings